SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000006838 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000006838
Domain Number 1 Region: 261-339
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.36e-28
Family Nuclear receptor 0.000014
Further Details:      
 
Domain Number 2 Region: 515-594
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.55e-19
Family Nuclear receptor ligand-binding domain 0.00000754
Further Details:      
 
Domain Number 3 Region: 334-382
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00000458
Family Nuclear receptor ligand-binding domain 0.0000964
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000006838   Gene: ENSMEUG00000007497   Transcript: ENSMEUT00000007509
Sequence length 598
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6087:550:9588:-1 gene:ENSMEUG00000007497 transcript:ENSMEUT00000007509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSF
STFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHSYQQHNHLPPQSEEMMPHSGSV
YYKPSSPPTPSTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQ
SPPGTPVSSCQMRFDGPLHVPMNPEPAGTHHVVDGQTFAVPNPIRKQAAMGFPGLQIGHA
SQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCL
ANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSP
PVSLISALVRAHVDSNPAMTSLDYSRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRHGLKEPKRVEELQSKIVNCLKDHVT
FNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF
Download sequence
Identical sequences ENSMEUP00000006838 ENSMEUP00000006838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]