SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000007546 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000007546
Domain Number 1 Region: 143-481
Classification Level Classification E-value
Superfamily Sema domain 7.85e-116
Family Sema domain 0.000000398
Further Details:      
 
Domain Number 2 Region: 477-526
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000227
Family Plexin repeat 0.0029
Further Details:      
 
Domain Number 3 Region: 11-79
Classification Level Classification E-value
Superfamily Sema domain 0.0000000196
Family Sema domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000007546   Gene: ENSMEUG00000008258   Transcript: ENSMEUT00000008281
Sequence length 1033
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_4794:391:16988:1 gene:ENSMEUG00000008258 transcript:ENSMEUT00000008281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRQYPVFRGRPSGNESQHRLDFQLMLKIRDTLYIAGRDQVYTVNLNEIPKAEVIPSEKLT
WRSRQQDRENCAMKGKHKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXGKLYSATVADFLASDAVIYRSMGDGSALRTIKYDSKW
IKEPHFLHAIEYGNYVYFFFREIAVEHNNLGKAVYSRVARICKNDMGGSQRVLEKHWTSF
LKARLNCSVPGDSFFYFDVLQSITDIIQINGIPTVVGVFTTQLNSIPGSAVCAFSMDDIE
KVFKGKFKEQKTPDSVWTAVPEDKVPKPRPGCCAKHGLAEAYKTSIDFPDETLSFIKSHP
LMDSAVPSIVEEPWFTKTRVRYRLTAIAVDHSAGPYQNYTVIFLGSEAGVVLKILAKTSP
FSLNDSVLLEEIDAFNHAKCNAESEEDRKVISLQLDQDHHALYVAFSSCVIRIPLSRCER
YGSCKKSCIASRDPYCGWLSQGACGRVKPGMLAGGYEQDTEYGNTAQLGDCHEILPTSTT
PDYKIFGGPTSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXVRWEVQSGDSNQMVHMNVLITCVFAAFVLGAFIAGVAVYCYRDLFVRKSRKI
HKDAESAQSCTDSSGSFAKLNGLFDSPVKEYQQNVDSPKLYTNLLTSRKELPPNGDTKSM
MMDHRGQPPELAALPTPESTPVLQQKTLQSMKSQSEKAHGASRKDTPQFFPSSPPPHSPL
SHGHIPSAIVLPNATHDYNTSFSNSNAHKAEKKLQNIDHPLTKSSKRDHRRSVDSRNTLN
DLLKHLSDPSSNPKAIMGDIQMPHQTLMLDPMGNMSEVPPKVPNREASLYSPPSTLPRNS
PTKRVDVPTTPGVPMTSLERQRGYHKNSSQRHSISAMPKNLNSPNGVLLSRQPSISRGGY
MPATGGAKMDYMQGTPVSVHLQPSLSRQSSYTSNGTLPRTGIKRTPSLKPDVPPKPSFVP
QTSSVRPLNKYTY
Download sequence
Identical sequences ENSMEUP00000007546 ENSMEUP00000007546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]