SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000007765 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000007765
Domain Number 1 Region: 199-212,253-499
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.04e-61
Family Nuclear receptor ligand-binding domain 0.00000000292
Further Details:      
 
Domain Number 2 Region: 148-219
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.4e-25
Family Nuclear receptor 0.0000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000007765   Gene: ENSMEUG00000008494   Transcript: ENSMEUT00000008517
Sequence length 532
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_1677:3896:69068:-1 gene:ENSMEUG00000008494 transcript:ENSMEUT00000008517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVKSSPSGLSSPAPYNCSQALVPLEHSPLYIPSSYVEGCHEYSAMAFYSPTVMNYNILF
KRVESEGGAVRQTTSPNILWPTPGHLSPLTLHCQSSLLYAEPPKGPWCEARAVEHVLPMS
RETMKRKVNGNSCNSPIINSPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQG
HNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMMKCXXXXXXCGYRVIRRQRNADEQI
CLSKAKKNSENVTRVKELLMNALSPEQFVLSLLEAEPPNVFVSRPSKPFTEASMMMSLTK
LADKELVHMIGWAKKIPGFVELSLYDQVRLLESCWMEVLMVGLMWRSIDHPGKLIFAPDL
VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMFPLATATEEP
ESSRKLHHLLNAVTDALVWVIAKSGISSQQQSIRLANLLMLLSHVRHASNKGMEHLLSMK
CKNVVPVYDLLLEMLNAHTLRGYKKSPVTVSDYGPSEQSESTDVGPQNLLSQ
Download sequence
Identical sequences ENSMEUP00000007765 ENSMEUP00000007765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]