SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000007972 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000007972
Domain Number 1 Region: 3877-4068
Classification Level Classification E-value
Superfamily Fibronectin type III 8.6e-37
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 2 Region: 2435-2624
Classification Level Classification E-value
Superfamily Fibronectin type III 6.19e-35
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 3 Region: 920-938,1521-1702
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.43e-31
Family Laminin G-like module 0.0036
Further Details:      
 
Domain Number 4 Region: 4734-4930
Classification Level Classification E-value
Superfamily Fibronectin type III 5.14e-31
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 5 Region: 4081-4265
Classification Level Classification E-value
Superfamily Fibronectin type III 2.94e-29
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 6 Region: 2622-2802
Classification Level Classification E-value
Superfamily Fibronectin type III 1.27e-28
Family Fibronectin type III 0.0047
Further Details:      
 
Domain Number 7 Region: 2927-3112
Classification Level Classification E-value
Superfamily Fibronectin type III 4.82e-27
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 8 Region: 4270-4388
Classification Level Classification E-value
Superfamily Fibronectin type III 1.25e-22
Family Fibronectin type III 0.005
Further Details:      
 
Domain Number 9 Region: 2199-2315
Classification Level Classification E-value
Superfamily Fibronectin type III 2.6e-22
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 10 Region: 1467-1512,1914-2053
Classification Level Classification E-value
Superfamily Fibronectin type III 3.11e-21
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 11 Region: 2775-2927
Classification Level Classification E-value
Superfamily Fibronectin type III 1.88e-20
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 12 Region: 1053-1193
Classification Level Classification E-value
Superfamily Fibronectin type III 1.57e-18
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 13 Region: 3592-3685,3767-3802
Classification Level Classification E-value
Superfamily Fibronectin type III 5.78e-18
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 14 Region: 2110-2226
Classification Level Classification E-value
Superfamily Fibronectin type III 7.9e-16
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 15 Region: 119-294
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000564
Family Pentraxin (pentaxin) 0.048
Further Details:      
 
Domain Number 16 Region: 1272-1288,1319-1404
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000111
Family Fibronectin type III 0.0053
Further Details:      
 
Domain Number 17 Region: 1767-1893
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000127
Family Laminin G-like module 0.0037
Further Details:      
 
Domain Number 18 Region: 3456-3533
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000188
Family Fibronectin type III 0.0049
Further Details:      
 
Domain Number 19 Region: 847-897
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000153
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 20 Region: 795-844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.0099
Further Details:      
 
Domain Number 21 Region: 694-744
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000265
Family Laminin-type module 0.0089
Further Details:      
 
Domain Number 22 Region: 747-788
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family Laminin-type module 0.0049
Further Details:      
 
Domain Number 23 Region: 1002-1050
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000019
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 24 Region: 2392-2443
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000215
Family Fibronectin type III 0.0072
Further Details:      
 
Domain Number 25 Region: 951-994
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 26 Region: 660-696
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000725
Family Laminin-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000007972
Domain Number - Region: 338-415
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00663
Family APC10-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000007972   Gene: ENSMEUG00000008627   Transcript: ENSMEUT00000008748
Sequence length 5227
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_421:1180:454866:-1 gene:ENSMEUG00000008627 transcript:ENSMEUT00000008748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYLAHSWDCRFFFHVIGTFILAYFASIPLASSQGLFPRLQNIGALKNVSVVPTQATCGL
PGRSVFCHSSTAAESIQYCTQRFCIQECPYRSSTPSYISLFSSDVRSCITADRNDLRPGS
PSNSTSFIFGNLKDCFFSPRSPKLAASFALAVWVKPEQEGVMCVIEKAVDGQIVFKLTIS
EKETMFYYRTVNGLQPPIKVMTLGRILVKKWIHLSVQVHHTKISFFINGLEDDHMAFDVK
TLSGPVTDLAPGAVRIGQSSNGSEQFIGRMQDFRLYQVALPNRDIMEVFSGELPYLHTQT
ECRCPVSHPRVHPLVQRYCLPNDADDTIDDRVLRLNSEAHPLSYINDNDIGTSWISHVFK
NMTELENGVGITIDLENGQYQVFYIVLQFFSPQPTGIRIQRKKLDDSDWEDWQYFARSCS
DFGMKNNGHLEDPDSVNCLQLPSFTPYSRSNITFSILTPEPNHRPGYNNFYKNPSLQEFV
KATQIRIHLRGQYYTTESSVNFRHRYYGVDEITISGRCNCHGHANDCDMASKPYRCLCSQ
ESYTEGRNXXXXXPLYNDKPFIKGDQVYALNCKPCQCNNHSRSCHYDVIMDPFPDEYHRG
GGGVCEYCQHNITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGG
QCNCKRHVSGRQCNQCQDGFYNLHELAPDGCSPCNCNTSGTVDGDITCHQNSGQCKCKRN
VIGLRCDRCDFGFKILQSFNKDGCEPCLCNIYGSVNKFCNPLSGQCKCKKETQGLQCDTC
VENFYGLDIGGCKACNCDAVGTFPGTVCNAETGQCTCKPNVGGRQCDQCLDGYYQLQQNN
SFFCLPCNCDKAGTINASLLCDKSTGQCPCKTGVIGLHCNHCEPHRYNLTISNLQGCQMC
ECDSLGTLAGAICDQISGQCPCLPNHQGRQCNQCKPGFYVSPDNKTGCLPCSCHTAGAVH
QVCNSLTGQCICQDASIIGQRCDHCKDHYFGFDPLAGRCHPCNCHLPGALNGSCHLVTGQ
CFCKQFVTGLKCDGCVPGASHLDIQNPFGCSKTPSQQPPPRGQVQSSSTINLSWHPPDSP
NAHWLTYSLFRDGTEIYTTEDKYPYGVQNFTDTTLLPYTSYSYHILTTSVHGSARSATVT
YRTKSGTPEGSLNLNYIIPISPYSVTLYWTAPLNDSGPIEKYILSCIPLDSLQSCGPYEG
LXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXIIIRYELYMRRLQLNDDLTMTESRVFQNSGWLNPQPVTASANENALTPP
KTTTIISDLEPYTNYEFSVVAVNMAGSVSSDWVSGKTAESAPVFMPPPSVFPLSPYSLNV
SWVKPGNSATRGEVARYKVNLISEQTPHQLAFLEVSQXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXPAHVRAPHVEGVNCTTMKISWPPPEKINGPSPIY
QLERKEISLPVLDTEMIKGIRFIGNGYYKFPSSTLPVNTDFTGIKVSFRTKEPEGLIVLA
VSPGNQEEYFALQLKRGRPYFLYDPQGSAVVVTTTNDNGKQYNDGRWHQVIATRHQTLGQ
ITVDGQFIGSSATSGSTIIGENTGVFVGGLPRGYAILRKDIEIIQKGFVGCLRDVFFKKS
HDPFEVWEPLQWQNAEEQMNVYSGWEGCPAVLTEGVHFLGTXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXTELKSGILSFLLKTCITFTQVDVWLGLSYCDGKWN
KVTVKKAGSVISASVNELMKHVSEANAQPLTVNSPVYVGGLPQELRETYEELSLEQGFGG
CMKDVKFTRGAVVNLASVSSGAVRVNLDGCLSTARTVNCRGNDSILVYRGKERSVYESGL
QPFTEYLYRVVASNEGGSAGSVWSRGRTKGTXXXXXXXXXXXXXXXXXXXXXXWDKPVGV
RGIIEKYIVKAYDKNSPHLPHVAAASVEFVNTSALTGTLTGLLPFKNYAVTLTACTLAGC
TESTHALNISTPQEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXLAVFMPHQFLLTACTLVGCTNSSQVTLFTAQLPPDNIDAPILTVLDSRTIY
VQWKQPEKLNGILERYILYVADHKQNITVWNVIYNSTELFQDHTIEHLFPGTRYLIKLAA
CTGGGCKISEISMALTDETVPEGVPAPKVQSYSSDSFNISWTKPEYPNGILTSYGLYIDG
VLMQNSSHLSYYAHGFAPWSLHSFRVQACTAKGCALGPLXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSNFTLLNDTRIMHCTEEANLWVSIS
GLVPFSNYTVQVNASNSQGSVISDPITIIMPPGAPDGVLPPRLSSATPTSLQVVWSTPVR
NNAPGSPSYQLQMRPSHSMDGILELFTHPSASLSYIVGDLQPYTSYELRLIASNGYGSTY
SDWTSFMTTEDKPGPIDPPFLLDVKSRTMTLKWQHPSRPNGVITHYNIYKNGHFHSLLPG
KTSNSTVLHLRPNTTYYFQVEGCTSKGCSLSPETQGVWTLPDAPEGIPSPELYSDTPTSV
VISWKLPLYPNGLVENFTIERRSKGMEQVTTLVTLPLNHSMKFIDQSVALSPWTKYEYRI
LMSTISGGTNSSAWVEVTTRPSRPAGVQPPDVLVLGPDMAKVTWSPPLIPNGDILSYEVC
MPDPRIMVTPSSSNTSIFSQIMAHLIPFTNYSVTIMACSGGGGHLGGCTESLPTYITTQP
TLPQGINPLSVTPVSESYIGVSWQPPSRPNGPHLRYELLRRKIQQPLASNPPEDLNLWRT
IYSGTQRFYEDKGLSRYTTYEYKLIVHNIVGYASSKEATVTTLAGIPEKSTTLVVQDFNH
TAVKVEWSKPTLKDLQGDVEYYTLIWSSATSNESVKILPDVNYFVIGDLKPNTEYQIFIC
IFNGAHSINSEVLHVTTCDGEPQGMLPPEVVIINSTAVRVIWTSPSNPNGVVTEYSVYVN
NKLYKTGMNAPGSFVLGDLSPFTIYDIQVEVCTKYACAKSKGTQITTVEDTPCEIAAPKI
HVISSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXECQKPEN
ICGHMCYSESKVCCDGILYDLKPGYVCCEDNYIPFRPNSSRVCCGGHMHEIQQKYQCCSG
HYTRVLPGEICCPDDEHQRVSVGIGDSCCKNIPYSTTGNQICCAGVLHDGYQQQCCGGLM
VGKELVCCGGEEEGKVHIRLPEMFCCGQDYVNMSDTICCSASSGESKAHVKKNDPVPIKC
CETELIPETQECCNGVGYNPLKYVCSDKISAGMMMKETKECQPASLCPTSMKDAAYCGRC
DFNLTSHVCALIRDPPQTSKKLSHEDVCPSAEEDVYIGNASTYSFIDVNLQPYRMYEYRI
AAWNSHGQGFSNASRAKTKQDVPQGVSPPTWTKMDNQEDVIVLNWKKPIQPNXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVAATIQGVPESVLPP
AITALSAEVLHLSWRVPEKPNGVIKEYQVNQSEKGLIHTDTKGRMQHTVTGLSAYTNYSF
TLTACTSVGCTTSQPTGSRTLQASPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXYVYQLEARTEGGSNTSDDYVLQTPESTPKEIY
APYNITVIDPYSIFVAWSPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXGCGVSSSILVTTFEAAPMDLKSPFLLTMGPTSILIRWLPPTKPNGV
IINYFIHRXXXGIEGDALIISEGPLEFTDASDTLKPFTIYEYCVRAHNSKGSVESPWSSA
QTMEAPPKGMRAPQAQATSAYSVLLNWTKPESPNGIISHYRIIYQEKQTDPTFNVPTVTA
FTVMGTRHQAHIFGLQPFTNYHIGIVAVNQAGEVSSSWTPVCTLESSPSGLSNFTVERKE
NGRALLLQWSEPIRTNGVIKAYNVFSDGNLEYTGLSRQFLFRRLEPFTFYILTLEACTMA
GCTLSAPQGLWTAEAPPTSQLAPTIQSVGATSIELSWSEPINPNGKIIHYEVIHRCFKGN
AEGNRTTQADEKIVFTEYNTERNTFVYNDKGLQPWTPYEYKIRTWNSAGHTDSPWSMVKT
KQAPPEGLLPPGLVFESLNPLRLMISWAPPEQPNGIIHSYRLQRNEVLYPFNFGAETFNY
TDDELLPYSKYRYAVIACTAEGCSTSQASTIQTPEAAPALVNPPSLWSLSATQINVSWSP
PPVPNGEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVWSGNSVGKTSSSWAQCKTGPAPPEGL
QAPKFHAVFSTQAVVNISTPLKPNGIVSLYRLFSNHTRGAEMVLSEGMATQQTIHDLEPF
TTYSIGVEACTCFNCCSKGPVAQLTTHPAPPSQQPPPQIQTLTSRTAYFQWNPPSSPNGI
VESYELELYIPCPASEMPCTPGPSEIKYTGQSQSAGIEDLQPYTSYKLRVVAYNLVGSTA
SEWISFTTEKEXXXXXXXXXXXXNLSVVYINWSGTFLLNSKLKEYVLTDGGQRLYSGLDT
SLYIPRTADRTFLFQVTCTTDEGSVKTPLIQYDTSTGLGPVLTTPGEKMGAGRKHAEFYN
ELWFIILMATLGLILLAIFLSLILQRKIHKEPYIRERPPLVPLQKRMSPLSVYPPGETHM
FDSVADISDVSSNVTLKSYTMHFEGLADTKIPRTGTPLSIRSNRSMSVLCIPSQSQISRT
YSQGSLHRSVSQLMDIQDKKGLTDDALWETIMGHDNGLYVDDEDLMNAIKGFSSVTKEHT
TFTDTHL
Download sequence
Identical sequences ENSMEUP00000007972 ENSMEUP00000007972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]