SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008224 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000008224
Domain Number 1 Region: 153-232
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 3.14e-32
Family Inhibitor of apoptosis (IAP) repeat 0.0000847
Further Details:      
 
Domain Number 2 Region: 10-96
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.24e-29
Family Inhibitor of apoptosis (IAP) repeat 0.00036
Further Details:      
 
Domain Number 3 Region: 233-306
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 3.66e-29
Family Inhibitor of apoptosis (IAP) repeat 0.0000176
Further Details:      
 
Domain Number 4 Region: 431-519
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000112
Family Caspase recruitment domain, CARD 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008224   Gene: ENSMEUG00000009002   Transcript: ENSMEUT00000009030
Sequence length 553
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_306:1528:11729:1 gene:ENSMEUG00000009002 transcript:ENSMEUT00000009030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVIEDSNLYELKYDFSCELYRISTYSNFPANVPVSERSLARAGFYYTGVNDKVKCFCCGL
MLDNWKQGDSAIDKHKQLYPSCDFIQNLNAVNNLGSPQSIFSSSGMNRITGSLSLSLEQS
GYFSGSYSSFPPEPVTSRVVENLSPLNTSFYCYSMNTEEARLLTYQTWPLTFMSPSDLAK
AGFYYIGPGDMVACFACGGKLNNWEPKDDAMSEHQRHFPNCPFLGNQIQETSRFNISNLS
MQSHAARMKTFVTWPPQIPVHPEQLASAGFYYMGCDDDVKCFCCDGGLRCWESGDDPWVE
HAKWFPXXXXXXXXXXXXXXXXXXXXXXXXXXXLLSTSDTPVDESVELPIIHFGPGENHS
EDAVMMNTSVVKAALEMGFNRRLIKQTVQSKILTTGENYKIVSDLVSDLLKAEDETREEE
KEQQAEEIESHDSLIQKNRMALFKHLTCVLPVLDSLLLNKKTKQKTIKQTQMSLQVRELI
DTILVKGNVAANIFKRCPRDFDPVLFENLFMEKNIKYIPAVDVSDLSIEEQLRLQEETCK
VCMDKEVSVVFIP
Download sequence
Identical sequences ENSMEUP00000008224 ENSMEUP00000008224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]