SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008443 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000008443
Domain Number 1 Region: 3326-3490
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.88e-27
Family Laminin G-like module 0.0044
Further Details:      
 
Domain Number 2 Region: 3495-3673
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.41e-23
Family Laminin G-like module 0.0043
Further Details:      
 
Domain Number 3 Region: 2930-3105
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000218
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 4 Region: 2722-2909
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000128
Family Laminin G-like module 0.021
Further Details:      
 
Domain Number 5 Region: 3161-3287
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000129
Family Laminin G-like module 0.022
Further Details:      
 
Domain Number 6 Region: 1960-2015
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000165
Family Laminin-type module 0.0014
Further Details:      
 
Domain Number 7 Region: 1912-1962
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000167
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 8 Region: 680-728
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family Laminin-type module 0.0071
Further Details:      
 
Domain Number 9 Region: 1577-1625
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000014
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 10 Region: 1438-1486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000179
Family Laminin-type module 0.0065
Further Details:      
 
Domain Number 11 Region: 544-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000204
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 12 Region: 303-364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000268
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 13 Region: 1528-1579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 14 Region: 362-421
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 15 Region: 497-540
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000179
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 16 Region: 727-776
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000234
Family Laminin-type module 0.0087
Further Details:      
 
Domain Number 17 Region: 779-829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 18 Region: 590-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000949
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 19 Region: 432-476
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000112
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 20 Region: 2014-2063
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000159
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 21 Region: 2061-2110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000008443
Domain Number - Region: 1819-1859
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000251
Family Laminin-type module 0.064
Further Details:      
 
Domain Number - Region: 1857-1906
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00326
Family Laminin-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008443   Gene: ENSMEUG00000009145   Transcript: ENSMEUT00000009268
Sequence length 3673
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_4030:7348:100199:-1 gene:ENSMEUG00000009145 transcript:ENSMEUT00000009268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARWGAGHRRGDTSLCALSLLLLLLVGLGRLRPLVKVEAGGVGFSLHPPYFNLAEGTRIS
ASATCGEEAPVGARGPPRPTEDLYCKLVGGPVAGGDPNQTIQGQYCDICTSANINKAHPI
TNAVDGTERWWQSPPLSRGLEYSEVNVTLDLGQLFHVAYVLIKFANSPRPDLWVLERSTD
FGLTYQPWQYFASSKRDCIERFGLQTLERITRDDDVICTTEYSRIVPLENGEIVVSLVNG
RPGAMNFSYSPLLRNFTKATNIRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDISIG
GRCVCNGHADVCDAKDPTNPYRLQCACQHNTCGGACDRCCPGFNQLPWKPATMDSANECQ
SCNCHGHAHDCYYDSEVDRHKASKNRDNVYEGGGVCVDCQHHTTGINCERCVPGYYRSPE
HPIDSPYVCYRCNCESDFTDGTCEDLTGRCYCKPNYTGERCDACAEGFTDFPHCYXXXXX
XXXXXXXXXXXXXXXXCDCSAAGTLGNACRKDPFIGQCVCKPNFQGVHCEQCAPGYYGPG
CLPCQCSGPGQIGSSCNNETGQCVCRAGFEGPACDRCAPGYFSYPLCQLCGCSPVGTLPE
GCDESGRCFCRPEFDGLHCDRCQAGYHSYPQCQXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXCHCSEVGSLHTTCDPETGQCNCRPRVTGLHCDACVPGTYGF
PRCEVGSCDPAGQASASSSLSETQGSCECRAHVEGPRCDRCKPLYWNLSPANPYGCRSCS
CDPRGTINGVAECQQGSGQCFCKPNVCGQMCTSCKDGYFRLDHADYFGCQTCQCDVGGAL
AQGCESRTGTCQCRPNTQGSTCSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXPKVVVKLNVTSPDLFHLVFRYVNRGSTSVNGKVSVLEEGKFNTC
SNCTEQTHQVIFAPSTEPMFLTVPQNSYGEPFVLNPSIWSLVIEAEGVLLDYVVLLPSAY
YEAPILQVKVTEACTYNPKPEQVRNNCLLYTYLPLDGFPFASGTDAICHLDNSLPKACQM
EQPSSSHPPLAACWGNDVDVQVQIIVPQPGQYALVVEYANEDDLQSVSVAVHTPQWTPQQ
GLLTLYPCQYSFLCRGTVLDSQNRLAANSEANIRLTTEHARFLLYRIYLVPMSKFTTEFV
EPRVHCISSHGTFGLSSGSCIPSRFQKLSQPIVLTECKVLPVPPDFPLNHVHTVTPAGPP
MSPQPRPPTAVDPTSDPTLLQSPQTTVVFSTHIQTLGRYAFLLHGYQPNHPTFPVEVVIN
GGRIWHGQANATFCPHAYGCRSLVVCEGQIVLDVTDNELTVTVRVPEGQQLWLDYVLVVP
EDGYNSNYLREEPLDRSYDFISLCAANGFYVSPTSSPPFCQDAAISLSLFYNNGAQPCRC
HEVGAMSPSCEPFGGQCPCRAHIIGRDCSRCATGYWGFPNCRPCDCGTRLCDEGTGQCIC
PPRTIPPDCVVCQPQTFGCHPLVGCEDCNCSRPGVKDFTDPGCDLDSGQCKCKPNIVGRR
CDSCAPGFYGYPSCRQCQCHKAGTVAGVCDPVTGQCHCKDNVEGVRCDQCRLGTFSLDAS
NPKGCTRCFCFGATDRCRSSQQVRGEXXXXXXXTLLSGEHQEVPFVWMGLDHADLRNVPE
AFQDLYWHAPASYLGDRVSSYGGSLRYELHSETQRGDVFVPAESRPDVILKGNQMSITFL
ESSYSTPGDIHRGKVDLVEGNFRHTATHNPVSREELMMVLAGLEQLQIRALFSQISSAVS
LQKVVLEVVTDAVGGAQASNVEVCMCPANYRGDSCQECAPGYYRDTKGHFLGKCIPCHCN
GHXXXXXXXXXXXXGCQHNTEGDHCERCKGGFVNNNPSSLCISCPCPLSVPSNNFAVECV
HKGGATQCLCQPGYAGASCERCAPGYYGNPLVIGSSCQPCDCSGNGDPNMLFSHCDPLTG
ACLGCMYHTAGPHCESCAPGYYGNALLPRNCTKCDCSPCGTEVCDAWTGRCLCKTGVTGQ
RCDHCQDGHYGFDSCGGCRPCNCGVAAIGSSCHPQTGQCHCQTGVSGAQCQQCAPGYWGF
SEHGCIRCQCRGGHCDPRTGECTCPPGLGGKQCDSCSHQHQVPSMARGIHCEVCDSCVVL
LLDDLERIESLFPTIRQQLSSLNASSVAWARLHGXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLI
SQMDRLSLSNTSAASGEEFLQTLGEVERMLQEMRGRNFGGPRAVAEEELGEAQRLLNRVQ
SQLSSRWEESQTLASSIRERLAQHSSQLMDLRDALNEAVNKTRLTEELNSRNQEHLEERL
RKKQELERENATLRDTLRMAEDALAQVSELLQTMDRAKEEYERLAANLDGARTPLIEKMQ
KFSPASSKIPITAGLKSHARELDQLAYNLSSIIRDTNQDRFIQRAIEASNAYASIIQAVG
KAEEAAGQALHNATNTWEMVIHGGLSGRARQLRENSSLLEEAVRSQQRKLSGVRETLQAS
RTQLEEAKAKKDRLVAQLKGVQSMLAMDRDDTSEKIARAKAVATEANDTATQVEATLRDM
QKNLDQWQGQYGDLKTQDLAQAMEDAGKSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXVKVPMKFNGRSGVQLRAPRDLQDLAAYTALKFYIQSSEPPQ
QQGQDGSSQFVLYMGSHEASGDYMGVILHEHKVQWVYRLGEAAHRTLTIDEDIGEQFATV
SIDRILQYGHMSVTMEKQTVHETKGDSVYPGDQGLLNLRPQDFVFYVGGYPSNFTPPRPL
RYPGYRGCIELDTLNEEVVSLYNFQRTFHLDTALDKPCARSKSTGDPWLTDGSYLDGTGF
AHISFESQMSSTKRFEQELRLVSYTGIIFFLQYQDQFLCLAVQEGLLKLYYDFSHGLQMA
TSQQELTPLTSSNKAIQIFIMGTTGRKRVLVRVERVSVFSLQEENMLENADSYYLGGVPL
AQLPPSLRSLFPTGGSIRGCVKGLKALGKYVDLKRLNTTGISSGCTSDLLXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEGIFQVSLRQGRVTLKFLRREV
MTRGAYADGVSHYVAVYSNDTGVWLYVDDQLQGTERQGVRSLRLQPGPPRFLLGGLPESG
AFQNLTGCISNVFVLRILVLRVLEAQRVVDLQQNIQNVNVTTGCSPPDEPLSSGHEVPKE
TKAVLHDQAIPPHSVCQFPTHPKTISNAYQFGASPASRLEFAHTPFSFQERTHFSMDVQL
RSPRGLLLAVPTVKSGSPFLVLYLSHGHFVLQAGGHGRPFRVRSHERYKPGGWHTVFFSR
EQNQIQLVIDGLQAQSSEGPRPRRRALGPWTIYVGGIPSGHSWTHLPEAAGTGFKGCMRN
LKLNGQPLETPAKLHGVIPCILTLEKGLFFAAEGGTVTLDPPKVWGPDLELVLEVHPWTA
AVLIFHLGKAGTTLYLKQMGTRVLVRANNGAGEFSTSVTRPPLCDGQWHRIAVIKGRNVL
QLEVDTEGNYTVGPSIITKEPLYLGGLPEPMVPPSSLPGYYGCIRNLVANHRPIDLTHTG
IIQGSVGANGCPV
Download sequence
Identical sequences ENSMEUP00000008443 ENSMEUP00000008443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]