SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008872 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000008872
Domain Number 1 Region: 258-451
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.06e-76
Family Nuclear receptor ligand-binding domain 0.00000000486
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008872   Gene: ENSMEUG00000009734   Transcript: ENSMEUT00000009760
Sequence length 457
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_9119:9635:56289:1 gene:ENSMEUG00000009734 transcript:ENSMEUT00000009760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSTQVNSTSLNSPTGRGSMAAPSLHPSIGPGLGSSLGSSSQLHSPISTLSSPINGMGPPF
SVISSPMGPHSMSVPTTPTLGFGTGSPQLNSPMNPVSSTEDIKPPLGLNGVLKVPAHPSG
TMASFTKHICAICGDRSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGW
NELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKT
ELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPDQPGRFAKLLLRLPAL
RSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
Download sequence
Identical sequences ENSMEUP00000008872 ENSMEUP00000008872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]