SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000008890 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000008890
Domain Number 1 Region: 131-157,189-330
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.82e-44
Family Nuclear receptor ligand-binding domain 0.000000251
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000008890   Gene: ENSMEUG00000009748   Transcript: ENSMEUT00000009780
Sequence length 524
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_986:252:35322:1 gene:ENSMEUG00000009748 transcript:ENSMEUT00000009780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFDCMDVLAVSPGQILDFYTASPSSCMLQEKALKACFSGLTQSEWQRRHTAQXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGFFRRSIQKNMIYTCHRD
KNCVINKVTRNRCQYCRLQKCFEVGMSKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTSLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFANQLLPLEMDDTETGLLSAICLICGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSS
SGNTAEHSPSISPSSVTVRLDSPHWCNKTFSSHFRHSPIPSVPGFKKQEKFFFLLLLSFG
TEKILKFKKDQEVFICTNIYPPHCLTLEIQTKMLKQPFHATRNS
Download sequence
Identical sequences ENSMEUP00000008890 ENSMEUP00000008890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]