SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000009008 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000009008
Domain Number 1 Region: 133-159,188-427
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.93e-66
Family Nuclear receptor ligand-binding domain 0.000000003
Further Details:      
 
Domain Number 2 Region: 80-165
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.85e-30
Family Nuclear receptor 0.00000936
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000009008   Gene: ENSMEUG00000009880   Transcript: ENSMEUT00000009903
Sequence length 429
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_8150:36180:38968:1 gene:ENSMEUG00000009880 transcript:ENSMEUT00000009903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRERGTEPLYIKAEPASPDSPRGSSEAEPEPPPARPPGPGPARRRLPTGREEDEEGEG
TGLGERGSGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCP
ASNECEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVEPLPFAGPF
PSAPLAPPGGTRKTAAPVNALVSHLLVAEPEKLYAMPDPAGPDGHLPAVATLCDLFDREI
VVTISWAKSIPGFSALSLSDQMSVLQNEWMEVLVLGVAQRSLPLRDELAFAENLVLDEEG
ARAAGLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALH
EALLEYEAGRAGGGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLF
LEMLEAMMD
Download sequence
Identical sequences ENSMEUP00000009008 ENSMEUP00000009008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]