SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000009009 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000009009
Domain Number 1 Region: 461-664
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.47e-45
Family Nuclear receptor ligand-binding domain 0.000000203
Further Details:      
 
Domain Number 2 Region: 407-489
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-25
Family Nuclear receptor 0.0000132
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000009009
Domain Number - Region: 718-766
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00497
Family Nuclear receptor ligand-binding domain 0.0000954
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000009009   Gene: ENSMEUG00000009869   Transcript: ENSMEUT00000009904
Sequence length 767
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_2791:1235:73019:-1 gene:ENSMEUG00000009869 transcript:ENSMEUT00000009904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSKESLSPSLGEETPKSIHGRSRGNVMDFYKIGGATVIPAPSSSLATSQSXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXMGLYMGDTDSKVMGNDLVFPQQGQIGVSSGETDFRLLE
ESIANLSKSSRVPQSPKSSASSATDNEFPTTSNFDKALEKPTLKKGLTGTNDGNAKLYTE
DQSTFDILHDLELSSGSPSKEANESPWRLDPLLEENCLLSPLATDESFLLEENVDEDCKP
LILPDTKPKITEQGGLILPSSNMPLPQVKTEKEDFIELCTPGVIKQEKLGPVYCQGSFSG
ANVIGNKMSAISVHGVSTSGGQMYHYDLNTSSLSQQQDHKPVFNVIPPISVGSESWNRCQ
GDDNLTSLGTLNFTNRSVFSNGYSSPGMRPDVSSSPSSSSTTAGPPPKLCLVCSDEASGC
HYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEA
RKTKKKIKGIQQPNPATTRENSESPVNKTMVPASLPQLTPTLVSLLEVIEPEVLYSGYDS
SVPDSTWRIMSTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMSFALGW
RSYKQASGSLLCFAPDLVINEQRMNLPCMYDQCKHMLLVSSELQRLQVSYEEYLCMKTLL
LLSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVE
NLLNYCFQTFLDKTMSIEFPEMLAEIISNQIPKYSNGNIKKLLFHQK
Download sequence
Identical sequences ENSMEUP00000009009 ENSMEUP00000009009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]