SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000009115 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000009115
Domain Number 1 Region: 145-368
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.96e-59
Family Nuclear receptor ligand-binding domain 0.00000000139
Further Details:      
 
Domain Number 2 Region: 49-72
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000438
Family Nuclear receptor 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000009115   Gene: ENSMEUG00000009980   Transcript: ENSMEUT00000010020
Sequence length 476
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_3779:1633:15396:1 gene:ENSMEUG00000009980 transcript:ENSMEUT00000010020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQKPSKLDCGSDPEENRSLDGKRKRKTSQCSLKTSMSGYIPSYLDKDEQCVVCGDKATG
YHYRCITCEGCKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXVLDDSKRVAKRKLIEENRERRRKEEMIRSLQQRPEPSPEEWDLIHLVTEAHRSTNAQG
SHWKQKRKFLPEDIGQSPMASMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFSEL
PCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLSGEMAVKREQLKNGGLGVVSDAIFDL
GKSLSAFNLDDTEVALLQAVLLMSSDRSGLLCVDKIEKCQEAYLLAFEHYINYRKHNIPH
FWPKLLMKERQSSVLYKERAAGDGEAGSLGIYSEGQQLLGMHVVEGTEVRQLKQLGEAGS
LGPVLDQCPKCSEQCLLQLFHRGRVLHTSVCWEKGRGQSDGERLESSLDMGITLFK
Download sequence
Identical sequences ENSMEUP00000009115 ENSMEUP00000009115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]