SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000009155 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000009155
Domain Number 1 Region: 262-454
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-59
Family Protein kinases, catalytic subunit 0.000000008
Further Details:      
 
Domain Number 2 Region: 149-293
Classification Level Classification E-value
Superfamily SH2 domain 3.9e-39
Family SH2 domain 0.00000131
Further Details:      
 
Domain Number 3 Region: 120-159
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000512
Family SH3-domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000009155   Gene: ENSMEUG00000010031   Transcript: ENSMEUT00000010062
Sequence length 454
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_9504:2063:22743:1 gene:ENSMEUG00000010031 transcript:ENSMEUT00000010062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSKSKPKDPSQRRRSLEPSESVLHSGFPASQTPSKVSVPDSHRTPNPSFGTTAPEPKL
FGGFNTSDTVTSPQRSGPLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
EGDWWLAHSLTTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNSENPRGTFLV
RESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHA
DGLCHRLTNVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAI
KTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKGDM
GKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDN
EYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSF
Download sequence
Identical sequences ENSMEUP00000009155 ENSMEUP00000009155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]