SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000009671 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000009671
Domain Number 1 Region: 375-635
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-54
Family YWTD domain 0.0000000207
Further Details:      
 
Domain Number 2 Region: 206-246
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000157
Family LDL receptor-like module 0.00053
Further Details:      
 
Domain Number 3 Region: 159-198
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000524
Family LDL receptor-like module 0.0006
Further Details:      
 
Domain Number 4 Region: 4-39
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 5 Region: 122-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 244-284
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 7 Region: 39-80
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 8 Region: 291-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000128
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 9 Region: 327-366
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000138
Family EGF-type module 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000009671
Domain Number - Region: 646-686
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000115
Family EGF-type module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000009671   Gene: ENSMEUG00000010590   Transcript: ENSMEUT00000010630
Sequence length 840
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6380:5174:89399:-1 gene:ENSMEUG00000010590 transcript:ENSMEUT00000010630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAKECEENQFQCGNKRCIPSVWRCDEDNDCVDNSDEDDCPKKTCSDSDFTCNNGHCIPER
WKCDGEEECPDGSDEAEATCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXCSPSEFQCSNRTCIATVFVCDGDDDCGDWSDERGCAAQVCGPQEFRCNSSTCIPER
WLCDGQADCEDQSDEVPELCGRQRTVVPATCSASEYPCGSGECIHLTWKCDGDADCKDKS
DEASCAVVSCRVEEFQCADGTCIQGARRCNHELDCPDGSDEAGCLQEANECAHNNGGCSH
ICKDLKIGYACECPPGYELLDKKTCGDINECDNPDACSQICINYKGYFKCECHPGYEMDT
LSKNCKAVAGMSPSMIFTNRHEVRRINLGKRDYTPLIPMLKNVVALDVEVATNRIYWCDL
FYRKIYSAFIDKANDRTEQVVLIDSQLHSPEGLAVDWVHKHLYWTDSGNKTISVATVDGG
RRKTLFNHDLSEPRAIAVDPLHGFMYWSDWGDQAKIEKSGLNGVDRQVLVLDNIEWPNGI
TLDLLSQRLYWVDSKLHQLSSIDFNGGNRKVLIFSVDALSHPFGIAVFEXXXFWTDLENE
AIFSANRLNGLEISVLAENLNNPHDIVIFHELKQPKAPDACEQSSQPNGGCEYLCLPAPQ
ISIHSPKYTCACPDSMWLGPDMKRCYRAPPSTSTTTLASTTVRTPGTNLLTTSPTSLPGH
MKNESSGELTSLGTAASEPSISASPPGVPSPRNSNHSQHYGTMGGKLVSTATAAIIGIIV
PVGVIALLGMSGYLIWRNWKRKNTKSMNFDNPVYRKTTEEEDEDEIHIGRTAQIGHVYPA
Download sequence
Identical sequences ENSMEUP00000009671 ENSMEUP00000009671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]