SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000009699 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000009699
Domain Number 1 Region: 802-850
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000218
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 2 Region: 848-900
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000262
Family Laminin-type module 0.0055
Further Details:      
 
Domain Number 3 Region: 909-959
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000307
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 4 Region: 957-1009
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family Laminin-type module 0.0036
Further Details:      
 
Domain Number 5 Region: 754-795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000145
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 6 Region: 443-487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000201
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 7 Region: 495-533
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000232
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 8 Region: 408-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000246
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 9 Region: 1065-1108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000218
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 10 Region: 1113-1161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000642
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 11 Region: 1009-1062
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000226
Family Laminin-type module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000009699   Gene: ENSMEUG00000010600   Transcript: ENSMEUT00000010661
Sequence length 1768
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_8043:1019:21329:-1 gene:ENSMEUG00000010600 transcript:ENSMEUT00000010661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAKALVQNPDLPSAGCSRGSCYPATGDLLVGRADRLTASSTCGLKGPEPYCIVSHLQDEK
KCFLCDSRHPFSARHPQSHRIQNVVTSFAPQRRSAWWQSENGVSTVTIQLDLEAEFHFTH
LIMTFKTFRPAAMLVERSSDFGRTWRVYRYFSYDCGSDFPGIPLAPPHRVDDVVCESRYS
EIEPSTEGEVIYRVLDPAIPITDPYSSRIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXCDCDPAGARDGGLCDPHDDPALGLVSGQCRCKEHVVGP
RCQRCRDGYFGLSTTDPQGCQRCQCDPRGTVPGGPPCDSNSGDCFCKRLVTGRHCDRCLT
DHWGLGHDLLGCRPCDCDVGGALEPWCAEDSGQCRCRRHMFGRRCDQVQPGYFLPYLDHL
TFEAEAARGQALEVVERIAHPGMAVSWTGMGFVRLQEGQTLEFLVDTVSQAMDYELLLRY
EPQVPEQWAEVALTVQRPGPISPSSPCGTTVPEDDRIRGMLQPGARYVILPYPVCLEPRV
SYTIRLELTRVGGDTRPGAPAPSLLLDSLVLLPRWSSLEMFSAGDASALERRATFERYRC
HEEGLMPAKGPPPEACAPLLRSLSALLYNGALACQCDPQGSLSSECQAHGGQCPCKTNVA
GRRCDHCAPGTFGFGPSGCRACQCSPEGSLSSLCHEASGQCSCRPGAFGPRCDRCQPGQW
GFPSCRPCHCNGHANECDPRTGSCQACRDHTAGDHCERCMAGFYGNPVLASGGHCRPCPC
PEGPGGQRHFATSCHQDRHSQQVICHCQPGYTGPRCEECAPGHFGDPLRPGGRCQPCECS
NNVDPMDPEACDRRTGQCLRCLHNSEGPRCAHCRSGYYGQAAHQNCRRCTCNFLGTEQQC
PSQDKCRCHPGSGQCPCLPNIQGQSCDRCAPNFWNLASGQGCQPCSCHPSHATSPSCNEF
TGQCHCRVGFGGRTCTECQENHWGDPGLQCRACDCDPRGIETPQCHHATGHCVCRPGVAG
VRCDQCARGFSGAFPACQPCHTCFGDWDRIVQGLASRTRALEQRARELHQLGALGAFEKN
FRLLGEKLGTVQGIVNARNATAAATLQLMATMEDLRHDIEEATGQLTKLEGELTDAQDEN
FNANHALSGLERXXXXXXXXXXXXXXXXXXXXXXXXXXAYDSIRQSHAQSFQAEHRANRS
ALAVPGPVSDSAGTRRQAEGLMGSQRDIFDRRNVANRRALGELAARTNSLSLTGINELVC
GAPGDAPCATSPCGGAGCRDEDGQRRCGGLNCQGAAATADNALGRARHTQEELRRTLGEG
GRVMDRVAEARLQAGEARQRAQAALEKANETRDRVERANQELRELIQNVKDFLSQEGADP
GSIETVATHVLELSIPASPAQIHHLAGEIAERVRSLGDVDTILQRTAGDVHQAEQLLQDA
QRARTRAQNEKQKAEMVQEALEESKRAQGAARGAIRGAAADTEGTEQTLGRVREKTAEAE
QDLSMAAERTQRLDAQLDALKLKRAGNSLEATRAEETANSAQGRAQEAEKLLKGQLGDRY
QTVRDLADRKAQGVLQAKERAERLRDEARGLLQDAQDKLRRLQELEGTYEVNERALEGKA
AQLDGLEAKMKGVLQSINQQIQIYNTCQ
Download sequence
Identical sequences ENSMEUP00000009699 ENSMEUP00000009699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]