SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000009715 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000009715
Domain Number 1 Region: 20-486
Classification Level Classification E-value
Superfamily Sema domain 9.29e-132
Family Sema domain 0.0000156
Further Details:      
 
Domain Number 2 Region: 1292-1418,1613-1802
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.2e-52
Family p120GAP domain-like 0.033
Further Details:      
 
Domain Number 3 Region: 983-1087
Classification Level Classification E-value
Superfamily E set domains 7.94e-16
Family E-set domains of sugar-utilizing enzymes 0.058
Further Details:      
 
Domain Number 4 Region: 896-984
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000392
Family Other IPT/TIG domains 0.019
Further Details:      
 
Domain Number 5 Region: 489-541
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000127
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 6 Region: 806-898
Classification Level Classification E-value
Superfamily E set domains 0.0000000000356
Family Other IPT/TIG domains 0.017
Further Details:      
 
Domain Number 7 Region: 1084-1157
Classification Level Classification E-value
Superfamily E set domains 0.0000042
Family E-set domains of sugar-utilizing enzymes 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000009715   Gene: ENSMEUG00000010615   Transcript: ENSMEUT00000010680
Sequence length 1832
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_2876:868:191157:1 gene:ENSMEUG00000010615 transcript:ENSMEUT00000010680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLLGGVWAVASSAEPPFRTFPVSDWSLTHLVVHNKTGEVYVGAVNRIYKLSSNLTLLRT
HVTGPVDDNEKCYPPPSVQSCPHGLVTTNNVNKLLLVDYAANRLIACGSTSQGICQFLRL
DDLFKLGEPHHRKEHYLSSVNESGTMSGVLIRSPGHDKLFIGTPIDGKSEYFPTLSSRKL
MENEENAEMFGFVYQDEFVSSQLKIPSDTLSKFPAFDIYYIYSFSSEQFVYYLTLQLDTQ
LTSPDSTGEQFFTSKIVRLCVDDPKFYSYVEFPIGCVQGGVEYRLVQDAYLSKPGKALAR
QLGVSEGEDVLFTVFAQGQKNRVKPPKESVLCLFTLKKIKDKIKERIQSCYRGEGKLSLP
WLLNKELGCINSPLQIDDDFCGQDFNQPLGGTVTIEGTPLFVDKEDGMTSVAAYDYQGHT
VVFAGTRSGRIKKILVDLSSPGGRPALQYENVVAHEGSSILRDLVLSPSRQYIYAMTEKQ
VTRVPVESCEQYTTCELCLGSRDPHCGWCVLHNICSRKDRCERADEPQRFASDLLQCVQL
TVRPKNISVTMSEVPLVLQAWNVPDLSVGVNCSFEDFTESESRIEDGKIYCRSPSSKDVV
PITRGQGDKRVVKLYLKSKETGKKFASVDFVFYNCSVHQSXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXDCPQILPSTQIYVPVGVVKPITLTAKNLPQPQSGQRNYECIF
HIPGNPARVTALRFNSTSIQCQNTSYTHERNDISDLPINLSVMWNGNFVTDNSQNIQFCL
KADWFECGWHVAEKPFPLWHHYNSLRLSPETGPRQGGTRLTITGENLGLKFEDVRLGVRV
GKVICSPIESEYISAEQIVCEIGDASLGRAHDALVEVCVRDCSPHYRAMSPKRFTFVTPT
FYRVTPARGPLSGGTWIGIEGNHLNAGSDVAVSIGGRPCAFSWRNSREIRCRTPPGQNPG
GANIVININRAELSNSDVKYNYTEDPTIQKIDPEWSINSGGTLLTVTGTNLATVREPRIR
AKYGSAERENTCIVYNDTTMVCQAPSIDNPTRSPPELGDRPDELGFVMDNVRSLLIINST
NFLYYPDPVFEPLSPSGILELKPSSPLILKGRNLLPPASGNSRLNYTVLIGSTPCVLTVS
ETQLLCESPNLTGQHKVTAGGFEFSPGTLQVYSDSLLTLPAIIGIGGGGGLLLLVIIVVL
IAYKRKSRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTHDLDGAGIPFLDY
RTYAXXXXXXXXXXXXXXXXXXVQANVEKSLTLFGQLLNKKHFLLTFIRTLEAQRSFSMR
DRGNVASLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKMLTNW
FTFLLYKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKMLT
LNCVNPENENAPEIPVKVLNCDTITQVKEKLLDAVYKGVPYSQRPKAGDMDLEWRQGRMA
RIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQNSAYNISNSSTFTKSLSRYE
SMLRTASSPDSLRSRTPMITPDLESGTKLWHLVKNHDHLDQREGDRGSKMVSEIYLTRLL
ATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQIHDYDVRHTWKSNC
LPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLGKDSPSNKLLYAK
DIPNYKSWVERYYSDIAKMPAISDQDMSAYLAEQSRLHLSQFNSMSALHEIYSYITKYKD
EILAALEKDEPARKQRLRSKLEQVIDTMALSS
Download sequence
Identical sequences ENSMEUP00000009715 ENSMEUP00000009715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]