SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000010198 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000010198
Domain Number 1 Region: 182-333
Classification Level Classification E-value
Superfamily Sema domain 1.7e-61
Family Sema domain 0.0000000423
Further Details:      
 
Domain Number 2 Region: 516-567
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000082
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 3 Region: 586-668
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000359
Family I set domains 0.027
Further Details:      
 
Domain Number 4 Region: 484-520
Classification Level Classification E-value
Superfamily Sema domain 0.00000129
Family Sema domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000010198   Gene: ENSMEUG00000011172   Transcript: ENSMEUT00000011211
Sequence length 749
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_928:20753:139676:-1 gene:ENSMEUG00000011172 transcript:ENSMEUT00000011211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWLRRIAYLFWGVLLAARANYQNVKNNVPRLKLSYKXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKECANFIKV
LKAYNQTHLYAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXGELYSGTAADFMGRDFAIFRTLGHHHPIRTEQHDSRWLNDPRFISVHLIPESDNPED
DKVYFFFRENAIDGEHTGKATHARIGQICKNDFGGHRSLVNKWTTFLNARLICSVPGPNG
IDTHFDELQDVFLMNSKDPKNPIVYGVFTTSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXEPTVISAMKISTKQQQLYVGSAAGVAQLPLHRCDIYGKACAECCLARDPYCAWDGS
SCSRYFPTAKRRTRRQDIRNGDPLTHCSDLQHHDNYNGHGFEEKIIYGVENSSTFLECSP
KSQRALVYWQFQRQNEERKEEIGVYDHIIKTEQDLLLRSLQRKDLGAYLCHAVEHGFMQT
LLKMTLEVTDTDHLDELLHKDDDSDSSKTKDISNSITLNQKVWYRDFMKRDKQRRQRLGN
SQASSNKWKHLQENKKDRNRRTQEFERAI
Download sequence
Identical sequences ENSMEUP00000010198 ENSMEUP00000010198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]