SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000010239 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000010239
Domain Number 1 Region: 135-161,211-385
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.41e-59
Family Nuclear receptor ligand-binding domain 0.0000000437
Further Details:      
 
Domain Number 2 Region: 82-156
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.27e-29
Family Nuclear receptor 0.0000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000010239   Gene: ENSMEUG00000011221   Transcript: ENSMEUT00000011254
Sequence length 385
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_4123:7156:21782:1 gene:ENSMEUG00000011221 transcript:ENSMEUT00000011254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYESVDVGVLTPSPNPFLVVDFYNQSRACLLSEKGIPASGPYSTPLRTPIWNNSSRSIET
QSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYT
CHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXSSGNTLRTTAQNSGSPWILTSGTSSVNSPKCIIKTVEFAKQ
LPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPL
TDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDKVDTLQEPLLEALKVYVRK
RRPSRPHMFPKMLMKITDLRSISAK
Download sequence
Identical sequences ENSMEUP00000010239 ENSMEUP00000010239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]