SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000010291 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000010291
Domain Number 1 Region: 239-416
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.00000131
Further Details:      
 
Domain Number 2 Region: 1-73
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.4e-16
Family BAR domain 0.022
Further Details:      
 
Domain Number 3 Region: 559-614
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000276
Family SH3-domain 0.00016
Further Details:      
 
Domain Number 4 Region: 120-208
Classification Level Classification E-value
Superfamily PH domain-like 0.000000936
Family Pleckstrin-homology domain (PH domain) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000010291   Gene: ENSMEUG00000011268   Transcript: ENSMEUT00000011310
Sequence length 615
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_7310:20978:111191:1 gene:ENSMEUG00000011268 transcript:ENSMEUT00000011310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADTQIDREHQNFYEASLEYVFKIQEVQEKKKFEFVEPLLSFLQGLFTFYHEGYELAQEFA
PYKQQLQFNLQNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGPL
GFTWIKHYCTYDKGSKTFTMSISEMKSSGKVKWSVTSSPEMKLKSCIRRKTDSIDKRFCD
IEVVERHGIITLQAFSEANRKLWLEAMDGKEPIYTLPAIISKKEESKSLLYLNEAGFNFV
RKCIQAVESRGITILGLYRIGGVNSKVQKLMNTTFSPKSPPDIDIDIELWDNKTITSGLK
NYLRCLTEPLMTYKLHKDFIVAVKSDDQNYRVEAVHALVHKLPEKNREMLDILIRHLVKV
SLHSQQNLMTVSNLGVIFGPTLMRAQEETVAAMMNIKFQNIVVEILIEHYEKIFHTAPDP
NIPLPQPQSRSGSRKTRAICLSTGSRKPKGRYTPCLAEPDSSYSSSPDSTMGSIESLSSH
SSEQNSTTKSASSQPREKSGGIPWIASPPPSNGQKSSGLWTTSPESNSKETPRAPPNPDL
PPKMCRRLRLDTTSSNGCFSQAKAMYSCKAEHSHELSFPQGAVFSNVYPSVEPGWLKATY
EGKTGLVPENYVVFL
Download sequence
Identical sequences ENSMEUP00000010291 ENSMEUP00000010291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]