SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000010318 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000010318
Domain Number 1 Region: 2-359
Classification Level Classification E-value
Superfamily Sema domain 1.83e-66
Family Sema domain 0.004
Further Details:      
 
Domain Number 2 Region: 1343-1466,1632-1813
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.22e-35
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 3 Region: 908-997
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000802
Family Other IPT/TIG domains 0.031
Further Details:      
 
Domain Number 4 Region: 478-530
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000654
Family Plexin repeat 0.0026
Further Details:      
 
Domain Number 5 Region: 996-1076
Classification Level Classification E-value
Superfamily E set domains 0.0000000000955
Family E-set domains of sugar-utilizing enzymes 0.036
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000010318
Domain Number - Region: 432-475
Classification Level Classification E-value
Superfamily Sema domain 0.00262
Family Sema domain 0.042
Further Details:      
 
Domain Number - Region: 637-674
Classification Level Classification E-value
Superfamily Plexin repeat 0.0785
Family Plexin repeat 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000010318   Gene: ENSMEUG00000011278   Transcript: ENSMEUT00000011339
Sequence length 1856
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_31:2299:154305:-1 gene:ENSMEUG00000011278 transcript:ENSMEUT00000011339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGKVYLAAVNRLYQLSGPNSLEVEEAVGPVRDNPLCHAPQLPQASCEHPKMLTNNYNKIL
QLDPGQGLVVVCGSIYQGFCQLRRLGNISAVAVSFPDLTTEPVTVFPSMLNVAANHPNAS
TVGLVLAAVGGPGGTRLLVGATYTGFGSQFFPRNQSLEDHRFENTPEIAIRSLDTRGDLA
KLFTFDLNPSDDNILKIKQRAKALHKLGFVRAFLHPGSGGPAPGTQAYAYLALNSEAKAG
DKESQSHSLLARICLPGGAAAETKKLTESYIQLRLHCGGPAGGEVFNRLLSVFPARRQLF
GVFERPWRAGTRAQSALCVFRFTDIEGAIRAARRACFVDPSPDVVAVLESVVQGTGPACE
KKRNIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXINLNATMNMMSRKSITVAYGEAVHHIMQFDPSDPSYLYVMTSHQMARVKVAVCDQ
YKTCPDCLAAEDAYCGWCAMETRCSLQHECANSSQPHFWTSASEGVQRCPSMTILPSEIN
IHQEYSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXHVTVQTAVQVNGRNIVWANFTIYDCTRTGHVYPHTACTSCLSTRWPCFWCTQQH
ACVSNVSECGNTPNPTDIQDCPRILPTPLAPVPTGGLQNIHVSLANTIFFSQXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXLHTPQRSQIFPVNLQLKGKPERFIDSPEKMTXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIVCWTGPSPSPFSDVVSVNVSKEG
KSRERYSYVLPVVYSMEPDVGPKAGGTRVTIRGSDLGVGSELHVLVNDTKQCLNLVRTDS
TITCTMPRGELLATVRVCVRFEHKSCISSNITFDYMRDPVIAAIRPRKSPVSGGRTITVE
GSRFDMIQNVSMMVNHIGKDQTICKVLNSTLITCPSPGATANKSAPVNFFINGQPYEDEQ
VAMEDPGEPKNMLPSSRFSLEYLPDPQFSTAKREKWIKHHPGEPLTLVIHXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIQVGNFNQTIATLQLGGSET
AITVSVVICSILLLLSIVGLFVFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQ
TDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEECYILPSQPLNSQGGAQVQETH
PLLLGEWKIPESCRPNMEEGIALFSTLLNNKHFLIVFVHALEQQKDFAVRDRCNLASLLT
IALHGKLEYYTSIMKDLLVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLRET
VGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDS
LSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRVEEVDLEWFASSTHSYILRDLDDTSVV
EDGRKKLNTLAHYKIPEGASLAMSLTDKKDSTLSRXXXXXXXXXXXXVLPTDELIESKKS
HKQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAIKYFFDFLEEQAE
KRGITDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQAFIDACSIS
DLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIHDMTPLSEQEMNAHLAEESRKYRNEFN
TKVAMAEIYKYAKRYRPQIMAALEANITTRRTQLQHKFEQVIALMEDNIYECFSEA
Download sequence
Identical sequences ENSMEUP00000010318 ENSMEUP00000010318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]