SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000010606 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000010606
Domain Number 1 Region: 2684-2973
Classification Level Classification E-value
Superfamily BEACH domain 1.44e-125
Family BEACH domain 0.0000000169
Further Details:      
 
Domain Number 2 Region: 3077-3246
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.51e-27
Family WD40-repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 2533-2585,2617-2650
Classification Level Classification E-value
Superfamily PH domain-like 0.000000184
Family PreBEACH PH-like domain 0.089
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000010606
Domain Number - Region: 469-513,578-656
Classification Level Classification E-value
Superfamily ARM repeat 0.000123
Family Armadillo repeat 0.084
Further Details:      
 
Domain Number - Region: 2343-2401
Classification Level Classification E-value
Superfamily Cyclin-like 0.00269
Family Retinoblastoma tumor suppressor domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000010606   Gene: ENSMEUG00000011580   Transcript: ENSMEUT00000011667
Sequence length 3523
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6913:55617:248337:-1 gene:ENSMEUG00000011580 transcript:ENSMEUT00000011667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMVKRIMGRPRQEECSPQDNALGLMHFRLFTELCHPPRHMTQKEQEEKLYMMLPVFNRX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAASRAIVQFLEINQSEEAS
RGWMLLTTINLLASSGQKTVDCMTTMSVPSTLVKCLYLFFDLPHVPEVVGGAQNELPLAE
RRGLLQKVFVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXKECLSTCVQNMQQSDDLSPLEIVEMFAGLSCFLKDSSDVSQTLL
DDFRIWQGYNFLCDLLLRLEQAKEAESKDALKDLVNLITSLTTYGVSELKPAGITTGAPF
LLPGFAVPQPAGKGHSVRNIQAFAVLQNAFLKAKTSYLPQIILDAITNIYIADNANYFIL
ESQHTLSQFAEKISKLPEVQTKYFEMLEFVVFSLNYIPCKELISVSILLKSSSSYQCSII
ATKTLLKFTRHDYIFKDVFREVGLLEVMVNLLHKYAAFLKDPQTLNEQGDSKNNSSVEDQ
KQLALLVMETLTILLQGSNTNAGIFREFGGARCAHNIVKYPQCRQHALMIIQQLVLSPSG
DDDMGTLLGLMHSAPPTELQLKTDILRALLSVLRESHRTRTVFRKVGGFVYITSLLVAME
RSLSCPPKNGWEKVNQNQVFELLHTVFCTLTAAMRYEPANSHFFKTEIQYEKLADAVRFL
GCFSDLRKISPLNVFPSNTQPFQRLLEDDLLSIDSVSPTLRHCSKLFIYLYKVATDSFDS
HAEQIPPCLTNESSLPSPWGTPAVSRKRHAYHSVSTPSGYPSKNVADVKQQPAASSLQSS
DAVVIHPGAMLAMLDLLSSVGSTSQPEXXXXXXXXXXXXXXXXXXXXXNQQVMCEAGLHA
RLLQRCSAALADEHSLHPPLQRMFERLASQALEPIVLXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSLVKSAEGSTVPLTRVK
CLVSMTTPHDIRLHGSSVTPAFVEFDTSLEGFGXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXLHYVHSTPGGSGSANPPVVSTVYAYIGTPPAQRQLASLVW
RLGPTHFLEEVLPISSVNVIYELGPNYVGSFQAVHVPCKDSKSESGVASPVXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLAISSHENATPVKLLHNSAGHLNGPARTV
GAALIGYLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLYAAVKALVCVVKSNPL
ASKEMERIKGYQLLAMLLKKKRSLLNSHILHLTFSLVGTVDSGHETSIIPNSTAFQDLLC
DFEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXFGQFIASTLPTFAVCEKFVVMEIKNEEKLDTGTEEDLG
GLVSANLILLRNRLLDILLKLVYSSKEKTSINIQACEDLVRTLGFDWLLMFTEEHLHSTT
VTAAMRILVVLLSNQSVLIKFKEGLSGGGWLEQTDSVLTNKIGTVLGFNVGRSAGGRSAI
REINRDACHFPGFPVLQSFLPKHTNVPALYFLLMALFLQQPVAELPENLQVSVPVISSRC
NQGCQFDLDSIWTFIFGVPASSGTVVSSIHNVCTEAAFLLLGMLRSMLNSPWQSEEEGSW
LREYPVTLMQFFRYLYHNVPDLSSMWMSPEFLCALAATVFPFNIRPYSEMVTDLDDEVGS
PAEEFKAFAVDTGMNRSQSEYCNVGSKTYLTNHPAKKFVFDFMRVLIIDNLCLTPASKQT
PLIDLLLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEDASLPITSGGSYQVLVN
NVFYFTQRVVDKLWQGMFNKESKLLIDFIIQLIAQSKRRSQGLSLDAVYHCLNRTILYQF
SRAHKTVPQQVALLDSLRVLTVNRNLILGPGNHDQXXXXXXXXXXXXXXXXXHVDGFGLE
AEARMTTWHIMIPSDIDPDGSCSQDVSEGRQLLIKAVNRVWTELIHSKKQVLEELFKVTL
PVNDRGLVDIAAARPLIEEAGLKCWQNHLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXEISQWMFTHIAVVRDLVDTQYKEYQERQQNALKYVTEE
WGQIEYELLRERGLWGPPIGSHLDKWMLEMTEGPCRMRKKMVRNDMFYNHYPYVPEIEQE
TNVLSAPPSKQLLPDDTTPQKKPARYRRAVSYDSKEYYMRLASGNPAFVQDAIVESSEGE
ATQQEPEHGEDTIAKVKGLVKPPLKRSRSAPDGGXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXIQHMYRCARVQGLDTSEGLLLFGKEHFYVIDGFTMTATREIRDIETLP
PXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIAVEVFSGDGRNYLLAF
QKGVRNKVYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGLLSTLVGEKSVTQRWERGEI
SNFQYLMHLNTLAGRSYNDLMQYPVFPWVLADYDSQEVDLTNPKTFRNLAKPMGAQTDER
LTQYKKRYRDWEDPNGETPAYHYGTHYSSAMIVASYLVRMEPFTQIFLRLQGGHFDLADR
MFHSVREAWYSASKHNMADVKELIPEFFYLPEFLLNSNNFDLGCKQNGTKLGNVILPPWA
KGDPREFIRVHREALECDYVSAHLHEWIDLIFGYKQQGPAAVEAVNVFHHLFYEGQVDIY
NINDPLKETATIGFINNFGQIPKQLFKKPHPPKRVRSRLNGDSSGASVPLGSASDKIFFH
HLDNLRPSLAPVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXAVTVYECLSEWGQILCAICPSPKLVITGGTSTVVCVWEMGTSKEKAKTLTLKQAL
LGHTDTVTCSTASLAYHIIVSGSRDRTCIIWDLNKLSFLTQLRGHRAPVSALCINELTGD
IVSCAGTYIHVWSINGNPIVSVNTFTGRSQQIVCCCMSEMNEWDTQNVIVTGHSDGVVRF
WRMEFLQVPETPAPEPVEDLEMQEDCPEAQIGQEGQEEDSSDSETEEQSIVQAPKEPPSQ
PGSVSHRPRAASCRATAAWSADSSSDDSRRWSDQLSLDEKDGFIFVNYSEGQTRVHLQGP
LNHPHPYPVDVRHFNNLKPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXCSRFQSEIKRLKISSPVRVCQNCYYNLQHERCPEDGPKNC
Download sequence
Identical sequences ENSMEUP00000010606 ENSMEUP00000010606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]