SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000010817 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000010817
Domain Number 1 Region: 148-513
Classification Level Classification E-value
Superfamily Sema domain 1.18e-143
Family Sema domain 0.000000000196
Further Details:      
 
Domain Number 2 Region: 32-102
Classification Level Classification E-value
Superfamily Sema domain 0.000000000000353
Family Sema domain 0.00063
Further Details:      
 
Domain Number 3 Region: 509-560
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000262
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 4 Region: 573-647
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000413
Family I set domains 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000010817   Gene: ENSMEUG00000011854   Transcript: ENSMEUT00000011907
Sequence length 701
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_223:9953:27345:1 gene:ENSMEUG00000011854 transcript:ENSMEUT00000011907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMLPALALFWGWGPRGGPAPPRLRLSFQELRARHGLRTFSLPRTCCYESLLLDEERGRLF
VGAQNYVASLSLDNISKQDKKLAWPAPVEWREECNWAGKDISXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXEPMLKLDLNSLEDGKGKSPYDPKHRAASVLVGQELYSG
VATDLMGRDFTIFRSLGRRPNLRTEQHDSRWLNEPKFVKVFWIPESENPDDDKIYFFFRE
VAVEGNPGLGRVLVSRIGQICRNDLGGQRSLVNKWTTFLKARLVCSVPGVDGTSDTAFDE
LRDVFLLPTKDRRSPLLYAVFSTSSSVFQGSAVCVYSMNDVRRAFLGPFAHKEGPNYQWV
SYQGRVPYPRPGMCPSKTFGTFGSTKDFPDDVIQFARNHPLMYNPILPVGGRPIFLRTGT
DYTFMQIVADRVAAADGHYDVLFIGTDIGTVLKVISVPKDSWQSTEGLLLEELQVFENAA
AISNMQISSKRHQLYVASQSSLSQLPLHRCAAYGRACAECCLARDPYCAWDGAACTRYLP
NTKRRYRRQDVRNGDPNILCSGDPPRQTLLEKKLFGVEGSSIFLECQPKSLQAQVLWTYQ
RAMIAPTQVHLDDRVIQTDRGLLLLSLGPQDTGLYHCHATEHGFTQPLRRLNLRMVGAHQ
AEQLTRGEETLGMGAGSPASHKLWYRDFLQLVDSPGRGGGG
Download sequence
Identical sequences ENSMEUP00000010817 ENSMEUP00000010817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]