SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011222 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011222
Domain Number 1 Region: 206-444
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-62
Family Nuclear receptor ligand-binding domain 0.00000000529
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011222   Gene: ENSMEUG00000012312   Transcript: ENSMEUT00000012345
Sequence length 446
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_319:1075:7864:1 gene:ENSMEUG00000012312 transcript:ENSMEUT00000012345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSWLGPPVSDITPDSVVELWKVESQDANSLGKAGSPFILGEEARTSHPSGGGSEVGQDA
GSTSILFPCSEVHPESTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLSEEQIRLKKQK
RQEEEQGQALGLPPRAPSPPLALPQLSPEQRGMIEKLVAAQQQCNQRSFSDLLRVTPWPL
APDPQSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSTIEVMLL
ETSRXXXXXXXXXXXXXXXXXXXXXXXXXXLQVEFINPIFEFSRSMNELRLNDAEFALLI
AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHPNDPLMFPRMLMKLVSLRTLSSVH
SEQVFALRLQDKKLPPLLSEIWDVQE
Download sequence
Identical sequences ENSMEUP00000011222 ENSMEUP00000011222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]