SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011268 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011268
Domain Number 1 Region: 53-523
Classification Level Classification E-value
Superfamily Sema domain 6.41e-130
Family Sema domain 0.0000169
Further Details:      
 
Domain Number 2 Region: 1362-1491,1687-1879
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.06e-46
Family p120GAP domain-like 0.04
Further Details:      
 
Domain Number 3 Region: 963-1052
Classification Level Classification E-value
Superfamily E set domains 7.38e-19
Family Other IPT/TIG domains 0.079
Further Details:      
 
Domain Number 4 Region: 526-576
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000235
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 5 Region: 868-964
Classification Level Classification E-value
Superfamily E set domains 0.0000000000407
Family Other IPT/TIG domains 0.012
Further Details:      
 
Domain Number 6 Region: 1052-1097
Classification Level Classification E-value
Superfamily E set domains 0.000000106
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.052
Further Details:      
 
Domain Number 7 Region: 822-860
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000445
Family Plexin repeat 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000011268
Domain Number - Region: 1192-1232
Classification Level Classification E-value
Superfamily E set domains 0.000887
Family E-set domains of sugar-utilizing enzymes 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011268   Gene: ENSMEUG00000012339   Transcript: ENSMEUT00000012394
Sequence length 1909
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_969:11091:213017:-1 gene:ENSMEUG00000012339 transcript:ENSMEUT00000012394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRAWRICLLSTPTLRMEQKRPWPRVPNSYGWPVVLFSVVWVLLLPVTAGTLQLSTFHSEN
RDWTFNHLTVHRGTGAVYVGAINRVYKLSGNLTIQVAHKTGPEEDNKSCYPPLIVQPCSE
VLTLTNNVNKLLIIDYSENRLLACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVNKT
GTMYGVIVRSEGEDGKLFIGTAVDGKQDYFPTLSSRKLPRDPESSAMLDYELHSDFVSSL
IKIPSDTLALVSHFDIFYIYGFASGGFVYFLTVQPETPEGVAINSAGDLFYTSRIVRLCK
NDPKFHSYVSLPFGCTRAGVEYRLLQAAYLSKPGDSLARALNISSQDDVLFAIFSKGQKQ
YHHPPDDSALCAFPIRAINTQIKERLQSCYQGEGNLELNWLLGKDVQCTKAPVPIDDNFC
GLDINQPLGGSTPVEGLTLFTTSRDRMTSVASYVYNGYSVVFVGTKSGKLKKIRADGPPH
GGVQYEMVSILKDGSPILRDMAFSIDQRYLYVMSERQVSRVPVESCEQYTTCGECLSSGD
PHCGWCALHNMCSRRDKCQRAREANRFVANISQCMSLKVKPSSMSVSEHSRLLSLTVSDA
PDLSAGVTCAFGNLTEVEGQVAGNQVICASPGVRDVPAIPVDQDWFGLELQLRSKETGKM
FVSTEFKFYNCSAHQLCLSCVNSAFRCHWCKYRNLCTHDPTTCSFQEGRINISEDCPQLV
PTEEILIPVGEVKPIALKARNLPQPQSGQRGYECVLNIQGIIYRVPALRFNSSSVQCQNS
SYQYDGMDISNLAVDFAVVWNGNFVIDNPENLKVHLYKCAAQRESCGLCLKADRKFECGW
CSGERRCTLHQHCSNPTWLDWSSHNVKCTNPQITEITMSGPPEGGTRVTIHGVNLGLDFS
EIAQHVQVAGVPCTPLPGEYIIAEQIVCEMGRALPGISSGPVRLCIGECKPEFMTKSHQQ
YTFVNPAVMSLAPIRGPESGGTMVTITGHYLGAGSSVTVFLGNQTCEFYGRSMNEIVCVS
PPSAHGLGPVPVSVSVDRAHVHSSLQFEYIDDPRVQRIEPEWSIASGHTPLTITGFNLDV
IQEPRIRVKFNGKESVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKNLCPPASGGAKLNYTVLIGET
PCAVTVSETQLLCEPPNLTGQHKVMVHVGGMVFSPGSVSVISDSLLTLPAIISIAAGGSL
LLIIVIIVLIAYKRKSRENDLTLKRLQMQMDNLESRVALECKEAFAELQTDINELTSDLD
RSGIPYLDYRTYAMRVLFPGIEDHPVLRELEVQGNGQQHVEKALKLFAQLINNKVFLLTF
IRTLELQRSFSMRDRGNVASLIMTGLQGRLEYATDVLKQLLSDLIDKNLENKNHPKLLLR
RTESVAEKMLTNWFAFLLHKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSED
KLIRQQIEYKTLILNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKNVPYSQRPRA
VDMDLXXXXXXXXXXXXXXXXITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQTSSYNIP
PSASISRTSISRYDSSFRYTGSPDSLRSRAPMITPDLESGVKVWHLVKNHDHGDQKEGDR
GSKMVSEIYLTRLLATKGTLQKFVDDLFETLFSTVHRGSALPLSIKYMFDFLDEQADRHS
IHDTDVRHTXXXXGRKSLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTS
EHRLGKDSPSNKLLYAKDIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFN
MLSALNEIYSYVSKYSEEIIGALEQDEQARRQRLSYKVEQLINAMSIES
Download sequence
Identical sequences ENSMEUP00000011268 ENSMEUP00000011268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]