SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011478 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011478
Domain Number 1 Region: 988-1116,1290-1439
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-29
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 2 Region: 3-232
Classification Level Classification E-value
Superfamily Sema domain 3.92e-18
Family Sema domain 0.027
Further Details:      
 
Domain Number 3 Region: 417-467
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000863
Family Plexin repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011478   Gene: ENSMEUG00000012564   Transcript: ENSMEUT00000012626
Sequence length 1506
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_4559:14:129092:1 gene:ENSMEUG00000012564 transcript:ENSMEUT00000012626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPWRSEQAIGALAASRRHGVFVASGSCLHQLDHTLQRQLSRLHQHPAGNCSEPVALAPPA
RPRPASSFSKLLLPYREGAAAGQDEGLLLTGWTFHRGRCDVRPLSNLNLSNPRSGTEVVS
CHPRGSTAGVVYQAPEDGRWYLAVAATHVLPDSEELNKCSPAASDLDTAITLQDTEKLFT
EEDGLLKLQKGAGTLHFVDAFLWNGSVYFPYYPYNYTSGAAPRAPAMARIAQSTRVDFQX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXVILGENLTSNCPEVIYEIKEEIPVFHKLVPDPENNTYIYLASGKEIRRIPMANCKN
HQSCTACLTAMDPHCGWCHSLQRCTFQDDCKQVGNVQTWLDISSGALKCPKIQIAQSSYY
QXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLAISVSFT
SDSWNLTEKFNFTNCSSLRECSVCVGSTCAWCENEKKCIHPFTACDPVDYRKNXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXVYSIHSIMPKKVSTLGKSDMIVTGANFTQASNISMILK
GTSTCDQDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSEHCTETQCNFLAPNLKSSKG
RPNVNVKMKVQDVLLDCNTLQYLDDPRFTGYRVDFLGVQELEVKIQLNCTFENVTRIQNL
PAIVHKNGXXXXXXXXXXXXXXXXVKLGNLELFVDQESVPSTWYFLIVLPVLLLIVIFVA
VVVTRHKSKELSRKQSQQLELLESELRKEIRDGFAELQMDKLDVVDSFGTVPFLDYKHFA
LRTFFPEXXXXXXXXXXXXXSRDPGEKNESLAALDALICNRSFLVTVIHTLEKQKSFSVK
DRCLFASFLTIALQTKLVYLTSILEVLTRDLMEQSSNMQPKLMLRRTESVVEKLLTNWMS
VCLSGFLRETVGEPFYLLVTTLNQKINKGPVDVITSKALYTLNEDWLLWQVPEFNTVALN
AVFEKIPENESTDVCRSIAVNVLDCDTIGQAKEKIFQAFLSKNGSLYGLQINEIGLELQL
GTRQKELLDIDSSSVILEDGITKLNTIGHYEXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXEAFQDVQAKRHGGKHKFKVKEMYLTKLLSTKVAIHSVLEKLFRSIWSLPNSKAPF
AIKYFFDFLDAQAENKKITDPDVVHIWKTNSLPLRFWVNILKNPQFVFDIKKTPHIDSCL
SVIAQAFMDAFSLAEQQLGKEAPTNKLLYAKDIPNYKEEVKAYYKAIRDLPPLSSLEMEE
FLTQESKKHENEFNEEVALTEIYKYIVKYFDEILNKLERERGLEDAQKQLLHVKVLFDEK
KKCKWV
Download sequence
Identical sequences ENSMEUP00000011478 ENSMEUP00000011478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]