SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011635 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011635
Domain Number 1 Region: 311-496
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-59
Family Protein kinases, catalytic subunit 0.000000346
Further Details:      
 
Domain Number 2 Region: 110-228
Classification Level Classification E-value
Superfamily SH2 domain 1.17e-30
Family SH2 domain 0.0001
Further Details:      
 
Domain Number 3 Region: 51-137
Classification Level Classification E-value
Superfamily SH3-domain 9.55e-18
Family SH3-domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011635   Gene: ENSMEUG00000012758   Transcript: ENSMEUT00000012797
Sequence length 497
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_923:2149:22414:-1 gene:ENSMEUG00000012758 transcript:ENSMEUT00000012797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NAIQSIFCCCCSVQKRQVRTQTNLKNDGNSSEEYTWCPKPLSYASTRKNRSNRGCVHSSK
RKPLPPLPQGEDHGEKIRVMALYDFLPRESRNLALKRAEEYLILEKYNPHWWKARDQTGK
EGLIPSNYVTEYKPTNLEIYEWYHKNITRNQAEDLLRQQSKEGAFIVRDSRRLGAYTISV
YSRRRRNDEMPIKHYQIKSHDSGQCYVSERHLFPSIPELIRYHQHNAAXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXKLSHSRLVQLYGVCTQQQPLYIVTEFMENGSLLHYLRERQGRLNKGMLL
SMCQDVCEGMEYLESNSFIHRDLAARNCLVSSTCIIKISDFGMTRYVLDDEYISSSGSKF
PVKWSAPEVFHFNKYSSKSDVWSFGVLMWEVFTEGKMPFAKESNLQVMEAVSKGFRLYRP
YLAPMTVYEVMYSCWHE
Download sequence
Identical sequences ENSMEUP00000011635 ENSMEUP00000011635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]