SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011658 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011658
Domain Number 1 Region: 2-400
Classification Level Classification E-value
Superfamily Sema domain 9.42e-131
Family Sema domain 0.0000000386
Further Details:      
 
Domain Number 2 Region: 397-449
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000101
Family Plexin repeat 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000011658
Domain Number - Region: 462-538
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00114
Family I set domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011658   Gene: ENSMEUG00000012785   Transcript: ENSMEUT00000012820
Sequence length 663
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6633:3796:13596:1 gene:ENSMEUG00000012785 transcript:ENSMEUT00000012820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPWEASPKKKRDCVFKKKSNETECFNFIRVLVAVNASQLYACGTFAFSPACTYIEVQDFS
LVPIPEEKILDGKGQSPFDPAHNHTAVLVDGMLYTGTMNNFLGNEPILMRTLGTQPVLKT
DAFLRWLQPDAAFVASIPSTQVVYFFFGETAKEFDFFEKLTISRVARVCKNDVGGERLLQ
KKWTTFLKAQLLCAQPGQMPFNVIRHAVLMPADPPASSKIYAVFTSQWQVGETRSSAVCE
FSLSDLEKVFEGKYKEMNKESSRWNTYSGPVSNPRPGSCSVGPSSDKALTFMKEHFLMDE
KVVGKPLLVKLDVEYTKLAVEMARDISGKGFLVMYLGSNTGSLHKAVVGKGSDTHLVEEI
QLFQKPEPIRNLLLAPAQGALFVGYSGGLLRVPRAKCSVYGSCIDCVLARDPHCAWDTVE
RVCRVFSNTSTDLNFLKQDVDLGNPEWACSNGPMGRSRRAHSPPQLIKEVLAPLHSILEL
PCPQTSTLATYHWTHRAIPIQTSSSAVYNGSLMLLLQEEVRGLYQCWATENGFTHPVVSY
WIQSQEDPLPLDPELAGIPRERVESPLTVGGPTPLATPRSYWSHFIIVTVLLALVLLGVL
IGLASSPLRALQAQRKVQGCSTLPPGEKAPLSEEPPVQPPKDTRTLNGGGVDADNNQLGT
EVA
Download sequence
Identical sequences ENSMEUP00000011658 ENSMEUP00000011658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]