SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011659 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011659
Domain Number 1 Region: 869-1143
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.82e-69
Family Protein kinases, catalytic subunit 0.00000858
Further Details:      
 
Domain Number 2 Region: 582-849
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.82e-41
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Domain Number 3 Region: 419-544
Classification Level Classification E-value
Superfamily SH2 domain 5.57e-16
Family SH2 domain 0.0029
Further Details:      
 
Domain Number 4 Region: 184-278
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000136
Family Second domain of FERM 0.006
Further Details:      
 
Domain Number 5 Region: 364-423
Classification Level Classification E-value
Superfamily PH domain-like 0.00000172
Family Third domain of FERM 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011659   Gene: ENSMEUG00000012769   Transcript: ENSMEUT00000012821
Sequence length 1151
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6722:74404:124192:-1 gene:ENSMEUG00000012769 transcript:ENSMEUT00000012821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLNFKEDCNAMAFCAKMRSYKKTEVNLDVLEPGVEVVFYLPDRKPLHLLSGEYTVEDLCI
RAAQECXXXPLCHNLFALYDEKTKLWYAPNHCIKIEDKTSLRLHYRMXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQYDLVKCLAPVRDPKTDQEV
HEIENECLGMAVLAISHYAMMNNIQLPDLPKDVSYKRYIPETLNKTIRQRNLLTRMRINN
VFKDFLKEFNNKTICDSSVTPHDLKVKYLSTLETLTKHYGAEIFETSLLLISSENEMNKL
NSKDCGNVIRYEVMVTGNLGIQWRQKPNVVPVEKEKSKLKRKKQESKHRKDEEKNKAREE
WNSFSYFPEITHVVIKESMVSINKQDNKKMELSLSSHEEALSFVSLVDGYFRLTADAHHY
LCTDVAPPLIVHNIENGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVTCL
ERSEQTLTSQKQYKNFQIEVKKGKYSLHGSDRVFPSLRGLMDHLKKQILKTDNISFVLKK
CCQPKPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEHLGRGTRTQIYSGTL
DYKDEEGSSDEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVXXXXXXXXXXXX
IMVEEFMEFGPLDLFMHRKSELLTTPWKFKVAKQLASALSYLEDKDLVHGNVCAKNVLLA
REGLDGECSPFIKLSDPGIPITVLSRQECVERIPWIAPECVDDSKNLSVAADKWSFGTTL
WEICYNGEIPLKDKTLAEXXXXXXXXXXPVTPSCKELADLMTQCMNYDHSQRPFFRAIMR
DINKLEEQNPDILSEKQPTTEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGE
QVAVKSLKPESGGNQIADLKKEIEILKNLYHENIVKYKGICTEDGGNRIKLIMEFLPSGS
LKEYLPRNKNKINLKQQLKYAVQICKGMDYLGSCQYVHRDLAARNVLVENEHRVKIGDFG
LTKAIETDKEYYTVKDDRDSPVFWYAPECLVQCKFYIASDVWSFGVTLHELLTYCDSESS
PMAMFLKMIGPTQGQMTVTRLVRALKDGKRLQCPPNCPEEVYQLMKKCWEYQPNNRTSFQ
NLIRGFEALIK
Download sequence
Identical sequences ENSMEUP00000011659 ENSMEUP00000011659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]