SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011849 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011849
Domain Number 1 Region: 175-439
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.03e-87
Family Nuclear receptor ligand-binding domain 0.000000000317
Further Details:      
 
Domain Number 2 Region: 70-153
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.13e-27
Family Nuclear receptor 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011849   Gene: ENSMEUG00000013000   Transcript: ENSMEUT00000013033
Sequence length 440
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_2633:452:46420:1 gene:ENSMEUG00000013000 transcript:ENSMEUT00000013033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQLQKEVPEIREKEEKKEMAMAEGVPDQNGGPESSLPSSSYSDLSQSSSPSLSDQLQMG
CDGASSGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCDRSCKVQKKN
RNKCQHCRFQKCLSLGMSHNAIRFGRMPEAEKRKLVEGLTASEVSRQNPQGADLKAFSKH
IYNAYLKNFNMTKKKARGILTGKASSTPPFVIHDMDTLWQAEKGVVWKQLVNGLPQYKEL
SVHVFYRCQCTTVETVREITEFAKSIPSFVSLFLNDQVTLLKYGVHEAIFAMLASFMNKD
GLLVADGNGFVTREFLRSLRKPFSEIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDR
PGLINVKQVEEIQDSILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQKIK
KTETETSLHPLLQEIYKDMY
Download sequence
Identical sequences ENSMEUP00000011849 ENSMEUP00000011849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]