SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011893 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011893
Domain Number 1 Region: 206-318
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000113
Family Second domain of FERM 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000011893
Domain Number - Region: 324-404
Classification Level Classification E-value
Superfamily PH domain-like 0.0574
Family Phosphotyrosine-binding domain (PTB) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011893   Gene: ENSMEUG00000013038   Transcript: ENSMEUT00000013081
Sequence length 423
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_9262:36750:40056:1 gene:ENSMEUG00000013038 transcript:ENSMEUT00000013081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMQFMGDPRKKDELDIPFEMLKLCWQNNLKDEIYCQLIKQVTENPKQEHCIRGWYLLNLL
TGYFLPSPTLMPYVTKYLQNAAPSQELAQKCQEHLQHTAKYGGRQHLPTIGEMKAFLEGN
TIRSLLLHLSGGMEYKTVIQTFTVVAEVQKELCTQMGIREPLEMQEFAIFLIKGKGQLVR
PLYLNEYLNDVVRETGVELHSHRLTWNTPLHYENEVYISMHYSQVHQDYLQGKLLVSTQH
QVEALLAPLAALQHLSREISNLPSEQDLLRYVPQPLQQQVNLKILGNLVESQLRNLKRYN
RKEAYINFIEAVRLLPLFGYKVYGVLRVSEPTIVTPCLLGLNHQHLILVDPSSQEQFYSI
NLKDIQKLRHLSPLDNTPGLELYYGSSANPKTIWFELPQAQELRHTLAFLMEYSTSTWPS
LNL
Download sequence
Identical sequences ENSMEUP00000011893 ENSMEUP00000011893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]