SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000011907 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000011907
Domain Number 1 Region: 41-114
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000733
Family HLH, helix-loop-helix DNA-binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 125-172
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000209
Family Hairy Orange domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000011907   Gene: ENSMEUG00000013058   Transcript: ENSMEUT00000013095
Sequence length 482
Comment pep:novel scaffold:Meug_1.0:Scaffold10895:16297:18991:-1 gene:ENSMEUG00000013058 transcript:ENSMEUT00000013095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEGISRLQERQFMEHRDFIGLDYSSLYMCKPKRGMKRDESKETYKLPHRLIEKKRRDRI
NECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKIIALQNGERSM
KSPIQADLDSFHSGFQTCAKEVMQYLSRFESWTPREQRCAQLINHLHSVSTQFLPSPQLL
TQQVPASKGTATSSSSSSSSIATPPCLDRTVQKLEPQTNCVPVIQRTQPSSELAGENDTD
TDSGYGGEGEARLTREKYHAPGGSHVTIKQEPPGEDSPEPKRMKLDCGESSNPGGSAAAA
LLGPNPAAALLRPDAALLSSLVAFGGGGGTPFGQPAAAAAAAPFCLPFYFISPSAAAAYM
QPFLDKSNLEKYLYPAAAAPSLLYPGIPAQAAAAAAAAAAAAAAFPCLSSVLSPPPEKAS
AAASTILPPELAPPAAPHQHFPLPLHPLAHLPFTASSREPGLSSDLETSSQGDSSQPGKE
NP
Download sequence
Identical sequences ENSMEUP00000011907 ENSMEUP00000011907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]