SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000012723 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000012723
Domain Number 1 Region: 209-353,384-462
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.73e-62
Family Nuclear receptor ligand-binding domain 0.0000000351
Further Details:      
 
Domain Number 2 Region: 140-222
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.95e-31
Family Nuclear receptor 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000012723   Gene: ENSMEUG00000013948   Transcript: ENSMEUT00000013989
Sequence length 467
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_5293:7431:66408:-1 gene:ENSMEUG00000013948 transcript:ENSMEUT00000013989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGNYSHFMKFPAGFGGSLSHTNSTSMSPSPALTTGKSTDSHSNYIEAPVSVPRTLASPL
SAVGSPLNALGSSYRVITSAIGPHSLSLATSPGVNMVGPASSQLNVVNNVRSSDDVKPLP
GIQGMGAMTYPSTSPGSLAKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCR
DNKDCLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAENEVESTSSGHEDMPV
ERILEAELAVEPKTESYGDTSMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLE
DQVILLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXAKGLSNPSEVEALREKVYATLEAYTKQKYPDQPGRF
AKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
Download sequence
Identical sequences ENSMEUP00000012723 ENSMEUP00000012723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]