SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000012778 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000012778
Domain Number 1 Region: 267-327
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-20
Family SH3-domain 0.00054
Further Details:      
 
Domain Number 2 Region: 11-48,88-139
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000000000117
Family BAR domain 0.00023
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000012778
Domain Number - Region: 194-226
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00023
Family BAR domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000012778   Gene: ENSMEUG00000014014   Transcript: ENSMEUT00000014049
Sequence length 332
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_5095:64971:83931:1 gene:ENSMEUG00000014014 transcript:ENSMEUT00000014049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFSEKISRVERTKLDEEFLELQRKTEVTRKAVEELLTKCTEYLQPNPXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQALLDIGESMKLMAEVKDSLDISV
KQNFIDPLQLLHEKDLKDIGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXIEQVSQLAVFIEAMRDYHRQSADILLELHRKLQHRXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXPSLLLNHPCCRAIFDFVPESEGELGFKEGDIITLT
SQIDENWYEGIFQGQSGLFPINYVSVLVPLPY
Download sequence
Identical sequences ENSMEUP00000012778 ENSMEUP00000012778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]