SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000013031 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000013031
Domain Number 1 Region: 232-297
Classification Level Classification E-value
Superfamily XPC-binding domain 1.27e-21
Family XPC-binding domain 0.0000365
Further Details:      
 
Domain Number 2 Region: 3-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.19e-21
Family Ubiquitin-related 0.000021
Further Details:      
 
Domain Number 3 Region: 305-365
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000114
Family UBA domain 0.00035
Further Details:      
 
Domain Number 4 Region: 152-207
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000178
Family UBA domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000013031   Gene: ENSMEUG00000014277   Transcript: ENSMEUT00000014320
Sequence length 367
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_8548:21698:26456:1 gene:ENSMEUG00000014277 transcript:ENSMEUT00000014320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVTVTLKTLQQQTFKIRMEPGETVKVLKEKIEAEKGRDAFPVSGQKLIYAGKILSDDVP
IRDYKIDEKNFVVVMVTKAKAGLATSAPPEPSAPAAANTPEPSTPAPPAPTIVAMPLPPP
APSEEKKSTEESAAGTPPEAGPGSLPSSGSSGQEDDAASTLVTGSEYETMLTEIMSMGYE
RERVVAALRASYNNPHRAVEYLLTGIPGSPESESGPAQESQAPEQPAPEGAGENPLEFLR
DQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPTGELADMSD
VEGEVGAIGEESPQMNYIQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLL
SQNFDDE
Download sequence
Identical sequences ENSMEUP00000013031 ENSMEUP00000013031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]