SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000013167 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000013167
Domain Number 1 Region: 284-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.85e-25
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 228-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.7e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 330-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000013167   Gene: ENSMEUG00000014432   Transcript: ENSMEUT00000014472
Sequence length 386
Comment pep:novel scaffold:Meug_1.0:Scaffold106633:13928:16953:1 gene:ENSMEUG00000014432 transcript:ENSMEUT00000014472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFRDVAVNFTPEEWGQLVPSQKELYREVMLENYRNLVCLGLAASKPDVICQLERGEAPRM
TEGDVIPRNDCPNWKTRPEAKESVPKLDISMESSSQKDPQDGMLVYNFRAAWGYDAGLKS
QQSRHSARKSSNTPSKAQDQECNTYDRSFSNGPAIFPQRMCVAGNLQDCHAEFRLYSDLN
SCNRICSKKIFSKYNEYRKSFSSKLDFIEYHRLYPAEQMYEHHDWGKAFSSCPSSNSHQA
VRIGEKPYLCNECGKAFFLSIHLIEHQRIHTGEKPYACNECGKVFRLNTQLTRHYTIHTG
EKPYECNECGKVFRQSAHLIRHQTIHTGEKPYECNECGKVFRLSAHLTCHQTIHTGEKPY
ECNECGKSFREKKGLIYHQRVHTGEK
Download sequence
Identical sequences ENSMEUP00000013167 ENSMEUP00000013167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]