SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000013171 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000013171
Domain Number 1 Region: 16-115
Classification Level Classification E-value
Superfamily SH2 domain 3.9e-20
Family SH2 domain 0.00034
Further Details:      
 
Domain Number 2 Region: 1189-1252
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000359
Family SAM (sterile alpha motif) domain 0.008
Further Details:      
 
Domain Number 3 Region: 403-527
Classification Level Classification E-value
Superfamily DNase I-like 0.0000000000514
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000013171   Gene: ENSMEUG00000014405   Transcript: ENSMEUT00000014476
Sequence length 1253
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_7242:2804:28462:1 gene:ENSMEUG00000014405 transcript:ENSMEUT00000014476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAGAGAAGRLGSPAPAWYHRDLSRAAAEELLARAGRDGSFLVRDSESVPGAFALCVLXXX
XXXXXXXXXXXXXXXXXXSSQGIPVRRFQTLGELIDLYAQPNQGLVCALLLPVEREAEVP
DERDYSDGEDEKPPLPPRSGSTSFSAGTGPNSPPPSLESPTTPATESTPNGLSTVTVSHE
YLKGSYGLDLEAVRGGASSLPHLTRTLVTSCRRLHSEVDKVLSGLEILSKVFDQQSSPMV
TRLLQQQSSTQTGEQELESLVLKLSVLKDFLSGIQRKALKALQDMSSTAPPTPLQPSTRK
AKSIPVQAFEVKLDVTLSDLTKIGKSQKFTLSVDVEGGRLVLLRRQRDSQEDWTTFTHDR
IRQLIKSQRVQNKLGIVFEKEKERTQRKDFIFVSARKREAFCQLLQLMKNKHSNQDEPDM
ISIFIGTWNMGSVPPPKNITSWFTSKGLGKTLDEVTVTIPHDIYVFGTQENSVGDREWLD
LLRGGLKDLTDLDYRPIAMQSLWNIKVAVLVKPEHENRISHVSTSSVXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXLSKPSDQAYIEFESVEAIVKTASRTKFFIEFYSTCLEEYKKSFEN
DAQSSDNINFLKVQWSSRQLPTLKPILSEIEYLQDQHLLLTVKSLDGYESYGECVIALKS
MIGSTAQQFLTFLSHRGEETGNIRGSMKVRVPAERLGTRERLYEWISVDKDEAGAKGKPP
SVSRGSQDYRSWSRKPVPAEASCPLSKLFDEPEKPPPMGRPPAPPRGAPREDPPPAPRSK
PEGAPEPEGMTAPPMKNSFNNPAYYVLEGVPHQLLPLDPPAPTPPAKVPAPSATKNKVAI
TVPPLQPGRRRPPRAGEGSSSDEEGGTLPPPDFPPPPLPDSAPDLPVVGPGGRGRGGVEI
RGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXIRESIQEDLAEEAPCPQGGRAGSLGEGSMGAWL
RALGMECYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDSLQHIK
Download sequence
Identical sequences ENSMEUP00000013171 ENSMEUP00000013171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]