SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000013314 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000013314
Domain Number 1 Region: 5-461
Classification Level Classification E-value
Superfamily Sema domain 3.92e-146
Family Sema domain 0.00000000833
Further Details:      
 
Domain Number 2 Region: 463-511
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000549
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 3 Region: 526-613
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000543
Family I set domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000013314   Gene: ENSMEUG00000014576   Transcript: ENSMEUT00000014622
Sequence length 787
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_1439:7386:13789:1 gene:ENSMEUG00000014576 transcript:ENSMEUT00000014622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSEARHFGGHAHNYSTLLLEEASGRLLVGARGALFSLNAQDIGDGSHREIRWEASPETQN
ECVRKGRNNQTECFNHVRFLQRLNATHLYACGTHAFQPLCAAIDSEAFTLPPSFEEGKEK
CPYDPARGFTGLIVDGGLYTATRYEFRSIPDIRRSRHPRSLRTEESPLHWLNDAEFVFSV
LIRESEASTVGDDDKVYYFFTERATEEGSSFSQIRGHRVARVARVCKGDLGGKKILQKKW
TSFLKARLTCHIPLYETLRSVCSLDGGSWAHTRFYAAFSLAAQWRTLEASAICRYDLSDV
QASFSGPYMEYQDGTRRWGRYDGAVPEPRPGSCITDGLRRRGYNSSQDLPSPVLDFVKLH
PLMARVVGPARGRPLLLKRNIRYTRLVGTPVTVPAGLTYDVLFLGTADGWIHKAVVLGLG
MHIIEEAQVFMEPQPVENLVISLAQHSLYVGAPSGVIQLPLSRCSRYSSCYDCILARDPY
CGWDPSVRACQEAATASNRCWTALIQDMERGNRGCQGIVTTEPHLPSRNRSVLSGDDVLL
PCDQPSNLARASWLLNGSRMLVDGRDGYRVGVDGLLVVDTRPEHSGHYSCYAEENGLRTL
LASYGLTVQQALPAPALVPPALGAHLTPDAHLLYVLTIAALGGLCLVLASMLLYVACLRG
SSRRRKYSLARGTGRAGGSAVQLQTVSGQCPGEEDEGEEGTDRAGGPEGSGLRXXXXPPP
PPPTELSNGLAALPSRLRRMNGNSYVLLQQNEDRAPTLPCSFTEELSRILEKRKHTQLVE
RLDESSV
Download sequence
Identical sequences ENSMEUP00000013314 ENSMEUP00000013314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]