SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000013453 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000013453
Domain Number 1 Region: 59-518
Classification Level Classification E-value
Superfamily Sema domain 2.22e-112
Family Sema domain 0.0000017
Further Details:      
 
Domain Number 2 Region: 514-562
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000129
Family Plexin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000013453   Gene: ENSMEUG00000014723   Transcript: ENSMEUT00000014779
Sequence length 1045
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_1395:39219:95206:-1 gene:ENSMEUG00000014723 transcript:ENSMEUT00000014779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSEALLLYLTLLHFAGAGFPEDSEPISISHGNYTKQYPVFVGHKPGRNATQRHRLDIQM
IVIMNRTLYIAARDHIYSVDIDTSNTEEIYCSKKLTWKSRQADIDTCRMKGKHKDECHNF
IKVLLKKNDDTLFVCGTNAFNPSCRNYKMDTLDSLGDEFSGMARCPYDAKHANVALFADG
KLYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVT
DVIHINGRDVVLATFSTPYNSIPGSAVCAYDMVDIANVFTGRFKEQKSPDSTWTPVPDER
VPKPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYRL
TKIAVDTAAGPHQNHTVVFLGSEKGIILKFLARTGNNGFLNDSLFLEEMNIYNPEKCSYD
GIEDKRIMGMQLDKASSSLYVAFSTCVIKVPLGRCERHGKCKKTCIASRDPYCGWVKEGS
SCTHLSPHTKLAFEQDIEHGNTDGLGDCQNSFVALNDISTSPPAHEMSYHTVHGHSSSLF
PSTTTSDTTGQEGYESGGHMQDWKDLLDSSDSTDPFGAVSSHNHQDKKGVIRESYLKGHD
QLVPVTLLAIAVILAFVMGAVFSGIIVYCICDHRRKDVSVTQRKEKELTHSRRGSMSSVT
KLSGLFGDTQSKDPKPEAILTPLMHNGKLTTPSNTAKILIKADQHHLDLAALPTPESTPT
LQQKRKPSRGSREWERNQNLINACTKDMPPMSSPVIPTELPLRASPSHIPSVVVLPITQQ
GYQHEYVDQPKMSDVTQMSLEDQAATLEYKTIKEHLSSKSPNHGVNLVENLESLPPKVPQ
REASLGPPGSSLSQNGLGKRLEMHPSSYGMDYKRSYPTNSLTRSHQAAALKRNNTNSSNS
SHLSRNQSFGRGDNPPPAPQRVDSIQVHGAPPTQAVTVSRQPSLNPYNSLTRSGLKRTPS
LKPDVPPKPSFAPLSTSMKPNDACT
Download sequence
Identical sequences ENSMEUP00000013453 ENSMEUP00000013453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]