SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000013577 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000013577
Domain Number 1 Region: 6-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.65e-48
Family BAR domain 0.014
Further Details:      
 
Domain Number 2 Region: 392-571
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-38
Family BCR-homology GTPase activation domain (BH-domain) 0.000000122
Further Details:      
 
Domain Number 3 Region: 265-365
Classification Level Classification E-value
Superfamily PH domain-like 3.92e-18
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 4 Region: 663-684,754-809
Classification Level Classification E-value
Superfamily SH3-domain 8.93e-17
Family SH3-domain 0.0000395
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000013577   Gene: ENSMEUG00000014865   Transcript: ENSMEUT00000014920
Sequence length 810
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_3454:33560:289238:1 gene:ENSMEUG00000014865 transcript:ENSMEUT00000014920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPALEFSDCCLDSPQFRDTLKSHEAELDKTNKFIKELIKDGKTLISALKNLSSAKRKF
ADSLNEFKFQCIGDAETDDEMCIXXXXXXXXXXXXXXXXXXXXXIENASEVLITPLEKFR
KEQIGAAKDAKKKYDKETEKYCGVLEKHLNLSSKKKEAHLHEXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXLLAFLQGLFTFYHHGYELAKDFSDFKTQLTISIQNTRNRFE
GTRSEVEALMKKMKENPHEHKTISPYTMEGYLYVQEKRHFGTSWVKHYCTYQRESKRITM
VPFDQKSGGKGGEDESVILKSCTRRKTDSIEKRFCFDVEAIDRPGVITMQALSEEDRRLW
MEAMDGQEPVYNSNKDIQSEGTAQLDTIGFSIIRKCIHAVETRGINEQGLYRIVGVNSRV
QKLLSVLMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMLPGPLMMYQFQRSFIKAAKLE
NQESRVSEIHALVHRLPEKNRQMLQLLMNHLANVANNHKQNLMTVANLGVVFGPTLLRPQ
EETVAAIMDIKFQNIVIEILIENHEKIFNTVPDALLTNTQQSLSWKKSSDSKPPSCSERP
LTLFHTVQATEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQPSVNSSDPELEVMKPSRP
SSLPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPIRSVAQFVFHVATAVFSFALSC
FHLLFWLLHRFGSCSPNLDLLTMRPKPEGFSSPFRKAKALYACKAEHDSELSFTAGTVFD
NVHPSQEPGWLEGTLNGKTGLIPQNYVEFL
Download sequence
Identical sequences ENSMEUP00000013577 ENSMEUP00000013577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]