SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000013770 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000013770
Domain Number 1 Region: 746-973
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.06e-58
Family DBL homology domain (DH-domain) 0.00000000139
Further Details:      
 
Domain Number 2 Region: 343-519
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.24e-46
Family Regulator of G-protein signaling, RGS 0.000000152
Further Details:      
 
Domain Number 3 Region: 977-1111
Classification Level Classification E-value
Superfamily PH domain-like 2.93e-41
Family Pleckstrin-homology domain (PH domain) 0.000000449
Further Details:      
 
Domain Number 4 Region: 22-85
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000639
Family PDZ domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000013770   Gene: ENSMEUG00000015066   Transcript: ENSMEUT00000015130
Sequence length 1543
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_9233:48487:112517:-1 gene:ENSMEUG00000015066 transcript:ENSMEUT00000015130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTNLSSLSDSAPEQKTPDHQTLDHHRQSSDSCETTGLVQRCVIIQKDQHGFGFTVSGDRI
VLVQSVRPGGAAMKAGVKEGDRIIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPEVQKHATQILRNML
RQEEKDLQHFQEVYSRNPASLLEERIEGARRRVTQLQRKIQQETGGSMDIVQMYDNTSKS
SEGRHSLDSQDGDSGLDXXXXXXXXXXXSLLKRNSMLSDPGLDSPRTSPVIMAKVAQHHR
RQGSDTTILPPTEQGLDHSAKPLIIGPEEDYDPGYFNNECDILFQDLEKLKYRPAHLGVF
LRXXXXXXXXXXXLFYLCAEVYLQTYPKDSRGLGKTIWAVFLEKNSPLRVKIPEALQAEI
DLRLRNNEDIRSPLSEAQEAAMPEIQEQIQDYRTKRTMGLGSLYGENDLLDLDGDPQRER
QIAERQLAALGDILSKYEEDRSVSMDFALNTYMSHAGIRLREARPSTAEKSQAIPDKDKW
LPFFPKTKKSSNAKKEKDALEDKKRNPILKYIGKPKSSSQNTFHVPLSPVEVKPGSVRNI
IQHFENSQQCDSPEPGMQRLSIGNFPEDLLESESSRSEIRLGRSESLKGREEMKKSRKAE
NVPRSRSDVDMDAAAEATRLHQSASSSASSLSTRSLENPTPPFTPKMGRRSIESPSLGYC
TDALLPHLLEDDLGHLSDLEPELDAQNWQHTVGKDVVAGLSQREIDRQEVINELFVTEAS
HLRTLRVLDLIFYQRMKKENLMPREELARLFPNLPELIEIHNSWCEAMKKLREEGPVIKE
ISDLMLARFDGAAREELQQVAAQFCSYQSIALELIKTKQRKESRFQLFMQEAESNPQCRR
LQLKDLIISEMQRLTKYPLLLENIIKYTDGSTSEYKKLCRARDQCRESLKYVNEAVKQTE
NRHRLESYQKRLDTTSLERASNPLAAEFKSLDLTTRRMIHEGPLTWRISKDKTVDLHVLL
LEDLLVLLQKQDEKLLLKCHSKTSLGSSDNKHTFSPVLKLNAVLIRSVATDKRAFFIICT
SELGPPQIYELVALTSLDKNMWMELLDGAVQNATRNPGIVPNPIHLSQTAPRQPSQHSST
PTSMGLTDSEVSQGNDCQPEIELLPKGDRSQQWVNGKHQALLEEPEQEGSEEELVAPTST
SSLGGGGLGVRTRGAVHLPLPGPLFMEGLADSALEDVENLRHLILWSLLPGHTIESRATV
EPEDDLTPTPSVIGITSHPWDPGSPGAASRDGGLELEPGELDDAALSSLEHLPPRARNSG
IWEHPELDRDMTEEPLNTEAVGAYKVVRKAEVAGSNAVPTLPECGKSETEPPEAGGGPNA
AGNCFYVSMPTGPPESNTDPPDVARSFSQQDAPNSSPAEPEHQGGSGDERRSQHTASSLA
LRDVGMIFRTIEQLTLKLNRLKDMETAHQELLKSLGAESSGGTTPVGGLNSEAVRWPESS
PSPPAKEPFSSSSKDSHEQGPRPEAGSDSLEDSPADTAISLGL
Download sequence
Identical sequences ENSMEUP00000013770 ENSMEUP00000013770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]