SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014368 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014368
Domain Number 1 Region: 461-586,623-710
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.11e-41
Family Nuclear receptor ligand-binding domain 0.0000000379
Further Details:      
 
Domain Number 2 Region: 356-434
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-23
Family Nuclear receptor 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014368   Gene: ENSMEUG00000015727   Transcript: ENSMEUT00000015778
Sequence length 725
Comment pep:known genescaffold:Meug_1.0:GeneScaffold_1136:50151:84594:-1 gene:ENSMEUG00000015727 transcript:ENSMEUT00000015778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPLLAASPQWPEAAAKPPRAEDGPESSAEHLPKGRSRALAGAAGVATAPTLPPAGGVPPV
PRDDPRFSAPRAAPPEQEQSTAPGRSPLATSLMDFIHLPILPINPAFLAARTRHLLDVEG
YEGGSEAFTQPRDSPASSSTPGAGGDFPDCAFQPDAEPKEDAYALYGDLQPPTLKIKEEE
EGGDRAARSPRSYLVPGPNPAVGPDYVLGPQLPLPPPQPRAPSSRPGDLAAPSSAPTSTS
VSSSSSSLSTLECILYKAESAPPQPGPFGPLHCKGPSAAGCLLPRDSLPSTSASAAAAAT
GAASTLYQPLGLPQLXXXXXXXXXXXXXXXXXXXXXXXPDTEASQSPQYGFEALPQKICL
ICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCIVDKIRRKNCPACRLRKCC
QAGMVLGGRKFKKFNKVRVMRALDAVAVPQPVGLPNESQALTQRITFSPNQEIQLFPPLI
NLLLSIEPDVIYAGYDNTKPETSSSLLTSLNHLAERQLLSVVKWSKSLPGFRNLHIDDQI
TLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXPLEGLRSQNQFDEMRSSYIRELIKAIGLRQKGVVASSQ
RFYQLTRFMDSLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPL
LFHKK
Download sequence
Identical sequences ENSMEUP00000014368 ENSMEUP00000014368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]