SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014398 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014398
Domain Number 1 Region: 5-394
Classification Level Classification E-value
Superfamily Sema domain 4.71e-96
Family Sema domain 0.00032
Further Details:      
 
Domain Number 2 Region: 1542-1651,1839-2025
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.9e-42
Family p120GAP domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 996-1091
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000345
Family Other IPT/TIG domains 0.0082
Further Details:      
 
Domain Number 4 Region: 1088-1175
Classification Level Classification E-value
Superfamily E set domains 0.000000000000882
Family Other IPT/TIG domains 0.037
Further Details:      
 
Domain Number 5 Region: 397-448
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000536
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 1172-1217,1249-1302
Classification Level Classification E-value
Superfamily E set domains 0.0000000000341
Family E-set domains of sugar-utilizing enzymes 0.075
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000014398
Domain Number - Region: 1316-1371
Classification Level Classification E-value
Superfamily E set domains 0.000638
Family E-set domains of sugar-utilizing enzymes 0.093
Further Details:      
 
Domain Number - Region: 552-583
Classification Level Classification E-value
Superfamily Plexin repeat 0.0131
Family Plexin repeat 0.0087
Further Details:      
 
Domain Number - Region: 957-991
Classification Level Classification E-value
Superfamily Plexin repeat 0.0419
Family Plexin repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014398   Gene: ENSMEUG00000015741   Transcript: ENSMEUT00000015813
Sequence length 2058
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6994:4629:52057:-1 gene:ENSMEUG00000015741 transcript:ENSMEUT00000015813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLECHAQLTDNPNQLLLVSPRGLVVCGSAHQGVCEQRRLDHIGQLLLRPERPGDTQYVAA
NDPAISTVGLVEQGPTGEPLLFVGRGYTSRGVGGGIPPITTRALRPPDPQAAFSYEETAK
LAVGRLSEYSHHFVTAFARRTSVYFLFLRRDLQAQSRAFRPYLSRVCLSDQHYYSYVELP
LSCGGAPYGLVQAAAVAVPGMGSQGDGGEVLFAAFSSVNPSTAGRPLAGVSGASALCAFP
LDEVDQLANRTRDACYTRDGRAEDGTEIAYIEYDVNSNCAQLPVDTLDAYPCGSDHTPSP
MASRVPLEATPLVEWADVQLTAVAVSVENGHTIAFLGDSQGQLHKVYLGPESDHRPYATQ
LIQSDSAVSSDLIFDGTLEHLYVMTQSTVVRVPVASCSQHLNCTSCLAPKDPYCGWCVLL
GRCSRRAECSRGRDPEPWLWSFSPESRCLQIQAVSPANVSREEKRNIFLSISDLPVLQPD
ELYSCHFEEYESPAVRTDTGVMCSSPDPSRTPALRMDADHVLVPLLLKFGEVVIASTEFS
FYDCAAVAVLYLSTPCQACVQSAWGCSWCVWQHLCTHKTACEAGPIVHSQRPLLSSVAPT
GDVHTFTPSVPPKAPVTPVPGTLLVESTSPSTDPIPLDTSPRAWASPHSPLAPQPGLCSI
PSTIGSEVTLGEEPSSLPSIPVDPGTMEGVGDTVTIVDAPGAVTRLEDLLPPAPSPSPLG
EQPSDTTVLTSSSWDLGTLTLSSSPPWGYAPSTGPSTTFPGVAGSKEHAPDWLPREDELP
EADEWTGSDASPFSTSTLLSGDGDSSEFEGPNAPHILLPDLDYQYDSPGLWELEEIVNHG
PAACPCVEGIEGSSLLPVQIEHELTLLGRNFHLYQDGLGDYECVLELEDHMEVTQARMEC
DGVTGTLCRIICQLHQLSYAALQPEFLVPVFLRKSGKLRMDSTEGLHVTLYDCSVGRPDC
SLCRTADPRYGCVWCDGHHPHCAAREACTEAEAALCPAPLIHMVEPLTGPVDGGTRITIR
GSNLGQKHQDIAETVTVAGVPCAVDAQEYEVSSSIVCVTGGSGEEKVGHVTVEVPGGGHG
ISDHKFAYQDPEVKSIFPIRGPKAGGTYLTLQGAKLLTGRLEDIRVLVGDHPCQQMEQLQ
CQTSPSPVSAELQVAVWFGGVERQLQQGLFQYTPDPNITSAGPAKSFVSGGRVIWVHGQN
LDVVQTPRIRVTVSSGAHQLSRGLGRRRRIIPETETECSQNTPCSTQYFEEPCHINSSQL
LVCRTPAIPGLPGGTWVQLEFILDNLLFDFATLHPTRFSYEANPILRPLNMEDPSSPFRH
KPGSVLSVEGENLDLAISKDEVVAMIGDGPCLVKTLTRNHLYCEPPAEQPPPRHREGLNS
LPEFTVQMGNLNFTLGRVQYDIESPLAFPVGAQVGLGVGASLLALGVLIIVFIYRRKSKQ
ALRDYKKVQIQLENLETSVRDRCKKEFTDLMTEMTDLTSDLVGSGIPFLDYKSYAERVFF
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFIHTLESQRTFSPRDRAYV
ASLLTVALHGKLEYFTDILRTLLSDLVTQYVAKNPKLMLRRTETVVEKLLTNWMSICLYT
FVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDLEYRPLTLNAVTVP
GVGLAEAPGIPVKVLDCDTISQAKEKILDQLYKGVPLAQRPEPGALDVEWRSGVAGHLIL
SDEDVTSVVQGAWRRLNTLQHYKVPDGATVALVPRFNKHIPRENQDYVPGEKTPMLEDMD
EGGIRPWHLVKPSEEPEPPRQRRGSLRGGDRERAKAIPEIYLTRLLSMKGTLQTFVDDLF
QVILSTSRPVPLAIKYFFDLLDDQAQLHGISDQDTIHIWKTNSLPLRFWINIIKNPQFVF
DVQTSDNMDAVLLVIAQTFMDACTLVDHKLGRDSPINKLLYARDIPRYKQMVERYYADIR
QTISASDQEMNSALAELSRNYSGDLSALVALHELYKYINKYYDQIITALEEDGTAQKMQL
GYRLQQIAAAVENKVTDL
Download sequence
Identical sequences ENSMEUP00000014398 ENSMEUP00000014398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]