SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014446 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014446
Domain Number 1 Region: 27-324
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.21e-60
Family Nuclear receptor ligand-binding domain 0.0000235
Further Details:      
 
Domain Number 2 Region: 2-50
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000296
Family Nuclear receptor 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014446   Gene: ENSMEUG00000015817   Transcript: ENSMEUT00000015863
Sequence length 328
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_2685:14882:29253:1 gene:ENSMEUG00000015817 transcript:ENSMEUT00000015863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGCPVDKTHRNQCRACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRGHKEENGAA
PHFPSAALPAPAFFTAVTQLEQHNLELAAVSGTPERQTLVGLAQPTPKYPHEVNGAPMYL
YEVATESVCESAARLLFMSIKWAKSVPAFSTLSLQDQLMLLEDAWRELFVLGIAQWAIPV
DANTLLAVSGMNGENTDSQKLSKIISEIQALQEVVARFRQLRLDATEFACLKCIVTFKAV
PTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPALRSISPST
IEEVFFKKTIGNVPITRLLSDMYKSSDI
Download sequence
Identical sequences ENSMEUP00000014446 ENSMEUP00000014446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]