SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014465 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014465
Domain Number 1 Region: 1-143
Classification Level Classification E-value
Superfamily Sema domain 4.32e-32
Family Sema domain 0.00056
Further Details:      
 
Domain Number 2 Region: 205-363
Classification Level Classification E-value
Superfamily Sema domain 2.94e-24
Family Sema domain 0.0012
Further Details:      
 
Domain Number 3 Region: 424-492
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000402
Family I set domains 0.05
Further Details:      
 
Domain Number 4 Region: 366-395
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000732
Family Plexin repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014465   Gene: ENSMEUG00000015833   Transcript: ENSMEUT00000015882
Sequence length 538
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_4895:4486:24790:-1 gene:ENSMEUG00000015833 transcript:ENSMEUT00000015882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DCENYITLLEKQREGLLICGTNARRPSCWNLTNQTLTPLGERRGYAPFSPDENSLVLFSD
DQVYSTIRKQEYNGKIPRFRRIGGERELYTSDMVMQNPQFIKATIINQDEAYDDKIYYFF
RENNPDKNPEAPMNVSRVAQLCKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXNYSAICVYSIGDIDRIFRTSPLKGYSGSLPNPRPG
KCLPDQQLTPTETFQVADSHPEVTQRVEPFGXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXKGTIHKVVESDHCAFNIMEIQPFRQHPATIQSMTLDNVTMKLYVNSQWEVSQ
VPLDLCSEYRGGCQGCLMARDPYCGWDGQCVSIYKYKGPVLQSLGPEEPHTECPSSKLEK
VSGESQSVTLARNSRYYLTCPVESHHATYSWHHGDKKVHRCEPGWQNSDCILFIEKLTDE
QYGLYRCKAEEGTYSRIAVQWELRKEATAEHLQMGRGGPQAQLCLRLLFALAVFLLFQ
Download sequence
Identical sequences ENSMEUP00000014465 ENSMEUP00000014465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]