SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014553 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014553
Domain Number 1 Region: 488-653
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 9.68e-72
Family A middle domain of Talin 1 0.0000000347
Further Details:      
 
Domain Number 2 Region: 753-888
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.16e-53
Family I/LWEQ domain 0.000000298
Further Details:      
 
Domain Number 3 Region: 2295-2486
Classification Level Classification E-value
Superfamily I/LWEQ domain 8.04e-51
Family I/LWEQ domain 0.00012
Further Details:      
 
Domain Number 4 Region: 658-782
Classification Level Classification E-value
Superfamily I/LWEQ domain 4.97e-48
Family I/LWEQ domain 0.00000067
Further Details:      
 
Domain Number 5 Region: 1225-1361
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.67e-38
Family VBS domain 0.014
Further Details:      
 
Domain Number 6 Region: 1862-1973
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.67e-35
Family VBS domain 0.0000027
Further Details:      
 
Domain Number 7 Region: 195-308
Classification Level Classification E-value
Superfamily Second domain of FERM 5.63e-34
Family Second domain of FERM 0.000000502
Further Details:      
 
Domain Number 8 Region: 309-399
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-25
Family Third domain of FERM 0.00000848
Further Details:      
 
Domain Number 9 Region: 1075-1207
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000000000000204
Family VBS domain 0.033
Further Details:      
 
Domain Number 10 Region: 1417-1555
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000000000000732
Family I/LWEQ domain 0.0076
Further Details:      
 
Domain Number 11 Region: 1696-1815
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000204
Family VBS domain 0.018
Further Details:      
 
Domain Number 12 Region: 2010-2132
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000565
Family VBS domain 0.027
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000014553
Domain Number - Region: 1598-1659
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00113
Family VBS domain 0.057
Further Details:      
 
Domain Number - Region: 949-1042
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00314
Family I/LWEQ domain 0.0042
Further Details:      
 
Domain Number - Region: 2100-2227
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0419
Family I/LWEQ domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014553   Gene: ENSMEUG00000015890   Transcript: ENSMEUT00000015975
Sequence length 2543
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_9664:19684:49989:-1 gene:ENSMEUG00000015890 transcript:ENSMEUT00000015975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEALAGPPNDFGLFLSDDDPKKGI
WLEAGKALDYYMLRNGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
ITNHEEYSLVRELLEEKKEEVTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
FQCQIQFGPHNEQKHKPGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML
EDSVSPKKSTVLQQQYNRIGRVEHGSVALPAIMRTGGSGPENFQTGSMPPAQQQITSGQM
HRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFETLPPLGQDAASKAWRKNKMDESK
HEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKMLAALLED
EGGSGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQIGESDT
DPHFQDMLMQLAKAVANAAAALVLNAKSVAQRTEDSGLQNQVVAAATQCALSTSQLVACT
KVVAPTISSPVCQEQLVEAGRLVAKAVEGCVAASQAATEDGSLLRGVGAAATAVTQALNE
LLQHVRAHATGGRPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAI
KADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMA
TNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASAPKGPAGPQPLLVQSCKAVA
EQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVSAAKASVPTIQDQASAMQL
SQCAKTLGTALAELRTAAQKAQEACGPLEMDSALSLVQSLERDLQEIKAAARDGKLKPLP
GETMEKCAQDLGNSTKAVSSSIAQLLGEVAQGNENYAXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXVLDTASDVLDKASSLIEEAKKAASRPGDPESQQRLAQVAKAVTQALNRCV
SCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAGLNQAATELVQAS
RGTPQDLARASGRFGKDFNTFLEAGVEMAGQAPSQEDQAQVVSNLKGISMSSSKLLLAAK
ALSTDPAAPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVRELLENP
AQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNSNLPEFGEAIRTASKALCGFTEAA
AQAAYLVGISDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQVLSAATIVAK
HTSALCNSCRLASSRTANPTAKRQFVQSAKEVANSTANLVKTIKALDGAFTEENRAQCRA
ATAPLLEAVDNLSAFAANPEFSSIPAQISPEGRAAMEPIVVSAKTMLESAGGLIQTARAL
AVNPRDPPSWSVLAGHSRTVSDSIKKLITSMRDKAPGQRECEAAIAALNSCLRDLDQASL
AAVSQQLSPREGISQEALHTQMLTAVQEISHLIEPLASAARAEASQLGHKVSQMAQYFEP
LTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAV
QMVTEAVEDLTATLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPDGSXXXXXXXXXXX
XXAIAVNVQEMVTKSSTSPEELGPLANQLTSDYGRLALQAKPAAMAAENEEIGAHIKHRV
QELGHGCAALVTKAGALQCSPSDAYTRKELMECARRVSEKVSHVLAALQAGNRGTQACIT
AASAVSGIIADLDTTIMFATAGTLNREGAETFADHREGILKTAKALVEDTKVLVQNAAAS
QEKLAQAAQSSVGTITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKA
AAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVF
CSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACK
EAAYHPDVAPEVRLRALHYGRECANGYLELLDHVLLTLQKPSPELKQQLTGHSKHVAGSV
TELIQAAEAMKGTEWVDPDDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLN
FEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQWSQGLISAARMV
AAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAG
NAVKRASDNLVKAAQKAAAFEDQENETVVVKERMVGGIAQIIAAQEEMLRKERELEEARK
KLAQIRQQQYKFLPSELRDEGQH
Download sequence
Identical sequences ENSMEUP00000014553 ENSMEUP00000014553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]