SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014586 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014586
Domain Number 1 Region: 1179-1478
Classification Level Classification E-value
Superfamily BEACH domain 2.88e-123
Family BEACH domain 0.0000000103
Further Details:      
 
Domain Number 2 Region: 1596-1849
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.37e-32
Family WD40-repeat 0.0039
Further Details:      
 
Domain Number 3 Region: 1060-1148
Classification Level Classification E-value
Superfamily PH domain-like 5.59e-22
Family PreBEACH PH-like domain 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000014586
Domain Number - Region: 5-96
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0124
Family Pentraxin (pentaxin) 0.048
Further Details:      
 
Domain Number - Region: 317-457
Classification Level Classification E-value
Superfamily Cytochrome P450 0.0853
Family Cytochrome P450 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014586   Gene: ENSMEUG00000015935   Transcript: ENSMEUT00000016011
Sequence length 1888
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_6635:580:55292:1 gene:ENSMEUG00000015935 transcript:ENSMEUT00000016011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFTPSGTGFEAFFTPAGMLVVAVCTRKEYMTVSLPEFPFNDSAWHSVAIIHVPGRRPFSQ
NLLYIYADGRLLKTAPLRCPSLNETFSSCCIGLAGQRTTTTTTGPPTSLVPTAVASAHPS
LSRSQSFPASMSSWGPRLAGPSREGGVSTTLAGSQDTEWGSPTSLEGQLGSVVIFHEVLQ
PAHIRTLYTLGPNETSPFKPEGEMQELSGKMLLHYTPQXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXCVGGMRVCPLEQVGSQPQEPEGQAETHDLVGPELTSSHNAQGLLIPL
GKSSEGRVERNGVAAFLLMVKNFLQGHLVNQESLMQCHGPAIIGALLQKVPSHCMDMNVL
MAAQMLMEQVASEGNGPLLHLLYQHLLFNFHLWSQSDFAVRLGHIQYLSSTIKEHRQRVR
KKYGVQYILDSVRAHYSSQRERPLAEDDLRTVQTSLFSLVKEFLARSFSPEEMMQLNYLA
GSSDEGQILNKLLKNDRVPERYKHRLKLKDCGLQGLIACLPEGPVSSHLCRGLSEQVLSA
GSGATVGSGENLTPVSLPSTPSPLEGGRPFPPFRGRHSSSLSNVLDETSFQEPSLGDDTS
NTSNPQQAPEEELCNLLTNILFSVTWRGVEGDDEAAWRERGQVFSVLTKLGAAGELVRPP
DEIKRSLLEMMLDSALTDIQEALPVALPSLTHHVLKLLRLLQDFLHSEGHGNQALWSEKL
FEGVSSLLDHLGVWQHLTNGATDLREMAQIGLRLVLGYMLLEDTQLHALAYVKLHGLLQT
AVPPRREEACYLLAKLEAPLARALEAESERCSWLVPLVRTLLDRAYTALGLQWGLPSLPP
TNGSPTFYEDFQAFCTSPEWRLFIDKQVQPTMSQFEMDTYARSHDHMSSFWNSCYDALMS
SSLRRDRERTESRHLFQELVLEPVMKRGRSEGKRYSSVQKQLASQHAIALLHWKALGRLL
TAPCSAWAQRNPPPPRWKLSSAETYSRMRLKLVPNYHFDQHSEASALRDNLLTPSTEDSL
PLSVAKEAKVSTLEEDQLGEEELTVLDTVTESSELGGQQEKLVLWEDCQLITIVAVIPGR
LEVTTQHLYFYDCSIEKEETEEGIGYDFRRPLSQLREVHLRRYNLRRSALELFFIDQANY
FLNFPRKVQKSTALYGPTLPPSKVRNKVYSCILGLRPPSQGYYGSHSPQEMLRASGLTQK
WVHREISNFEYLMQLNTIAGRTYNDLSQYPVFPWILQDYTSETLDLNDPSVFRDLSKPIG
VVNSKHAQLVREKYESFEDPTGTTDKFHYGTHYSNAAGVMHYLIRMEPFTSLHIQLQSGR
FDCSDRQFHSVAAAWQARLESPADVKELIPEFFYFPDFLENQNGFDLGSLQLTNEKVGDV
VLPRWARSREDFIHKHRKALESEHVSAHLHEWIDLIFGCKQRGPAAVEALNVFYYCTYEG
AVDLDAVADETERKALEGIISNFGQTPCQLLKEPHPPRLSAEDAARRLARLDTYSPNLFQ
NLDQLKSFFVEGISDGVPLVLAVVPHRQSHSFMTQGSPDLLVTVSANGLLGTHNWLPYDR
NISHYFTFXXXXXXXXXXTQRLLSGPWAPGGGVSGRALAVAPDGKLLFSGGHWDGSLRVT
TLPRGKLLSQLSRHIDVVTCLALDLCGLYLISGSRDTTCMVWQVLQQGGLSAGLAPKPVQ
VLYGHEAEVTCVAISTELDMAVSGSKDGTVIIHTIRRGQFVASLQPLGGTVPGPVAHLAL
GPEGQIVVQSLAQERPGAQMSYFLHLYSVNGRLLASQKLEEQPTALALSDAFVLLGTAQC
NLHILHLHSLVQAVPSLSMKVPIYSVAVTKERSHILVGLEDGKLIVVGAGQPSEVRSGQF
ARRLWRSTRRISQVSSGETEYNPPEACP
Download sequence
Identical sequences ENSMEUP00000014586 ENSMEUP00000014586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]