SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000014747 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000014747
Domain Number 1 Region: 668-912
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-65
Family Nuclear receptor ligand-binding domain 0.000000000241
Further Details:      
 
Domain Number 2 Region: 551-628
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.97e-25
Family Nuclear receptor 0.0000166
Further Details:      
 
Weak hits

Sequence:  ENSMEUP00000014747
Domain Number - Region: 382-412
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.068
Family Formin homology 2 domain (FH2 domain) 0.057
Further Details:      
 
Domain Number - Region: 49-96
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0811
Family beta-sandwich domain of Sec23/24 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000014747   Gene: ENSMEUG00000016129   Transcript: ENSMEUT00000016176
Sequence length 914
Comment pep:known genescaffold:Meug_1.0:GeneScaffold_7730:13138:115424:1 gene:ENSMEUG00000016129 transcript:ENSMEUT00000016176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVQLGLGRVYPRPPAKTFRGAFQNLFQSVREVIQNPGARHPGAVAGAAPPGARLQQHHHH
QQHHQHHQQQQAPHQPQHQQSSPRQPQPPGQHQAPDDGSPCTPSRGPAGYLALEEDSPSQ
PSQSSAEGCPENGCVPEPGPTASAGKGLQQQAVVVVAAAAPDDDDSAAPSTLSLLGPSFP
GLSSCSADLKDILAEAGTMQLLQQQQQEAAVAADGGSGIRAREESGAASSKDNYLGVTST
ISDSAKELCKAVSASMGLGVEALEHLSASDQLRGDCMYAQLLGGPSASRPAPPCAPLTDC
KGSLLDDCGGAEEAAEYSPFKGTYAKALDGESLGCCGGAAVGSAGALEMQSALTLYKAGP
LDEVTTYQNRDYFNFQLSLTGPPPPPPPPHHQHARVKLENPLDYGSTWAAAAAQCRYGDM
ANLGHSGAAAAGPGSGSPSAAASSSWHNLFASEESQMYGQCGGASAAGEPAPVAPYGYRA
AQGLAGQEADFPPAEVWYPSGVVSRVPYPGPGCVKSELGPWMEGYSGAYGDMRLDAARDH
VLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDK
FRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGDASSSTSPNDDQGQKLTVSHIE
GYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGF
RNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCV
RMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACK
RKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPK
ILSGKVKPIYFHTQ
Download sequence
Identical sequences ENSMEUP00000014747 ENSMEUP00000014747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]