SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMEUP00000015298 from Macropus eugenii 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMEUP00000015298
Domain Number 1 Region: 103-160
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000106
Family TNF receptor-like 0.002
Further Details:      
 
Domain Number 2 Region: 207-272
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000571
Family DEATH domain, DD 0.028
Further Details:      
 
Domain Number 3 Region: 36-83
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000106
Family TNF receptor-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMEUP00000015298   Gene: ENSMEUG00000016739   Transcript: ENSMEUT00000016790
Sequence length 401
Comment pep:novel genescaffold:Meug_1.0:GeneScaffold_7143:746:29296:-1 gene:ENSMEUG00000016739 transcript:ENSMEUT00000016790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKFLCCTLVFLDISVKWTTQETFPPKYLHYDPETSRQLLCDQCPPGTYLKQHCTTRRQT
QCEPCPHHYYTKSWHFNEECLYCSGMCKELQYVKQECNSTHNRVCECVEGRYLELEFCLR
HTSCPPGFGVVQAGTPERNTICKRCPDGFFSDETSSKAPCRKHTDCSALGFQMASKGNAT
HDNLCAGKTEATQKXXXXVTLCEEAFFRFAVPTKFTPNWLSVLVDSLPGTKVNAETIERI
KRRHSSQEQTFQLLKLWKHQNKDQDMVKKIIQXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXKTVKFLHSFTMYRLYQKLFLEMIGNQVQSSKISCL
Download sequence
Identical sequences ENSMEUP00000015298 ENSMEUP00000015298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]