SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|426404331|ref|YP_007023302.1| from Bdellovibrio bacteriovorus str. Tiberius

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|426404331|ref|YP_007023302.1|
Domain Number 1 Region: 750-840
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.0000000000000173
Family Intein (protein splicing domain) 0.012
Further Details:      
 
Domain Number 2 Region: 66-183
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000157
Family PKD domain 0.0038
Further Details:      
 
Domain Number 3 Region: 220-261
Classification Level Classification E-value
Superfamily PKD domain 0.00000000275
Family PKD domain 0.0022
Further Details:      
 
Domain Number 4 Region: 486-534
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000017
Family TSP-1 type 1 repeat 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|426404331|ref|YP_007023302.1|
Sequence length 883
Comment cell surface protein [Bdellovibrio bacteriovorus str. Tiberius]
Sequence
MEAASYCAGQLSKASSEDVRIVGKSATEAGSTVSYSLDQAGNCVSSSDVTWKVAGVSRTK
TSSSGMTSTFKLAGTYVVTAQEKTAGSEDISLSLVTTVVKEDLKISGPQAGFVFNPMSFE
LVIPSGLDAQSIVWNFNDGTATVSNVRTVEHSFFNVGTYQVQATVTDADGKVTVASHRVT
VMTVIDDMDCLEDLRISGANEAKVKIATMMHVYLPVCLVNKVGAVRWNFGDGGTAANQSV
THAYQAVGTYAVTATLYLGDNQEPWVTLDHSIRVIEDLDVEPEPEVPVDPMACTVAGATR
ESQGELSSEEVACGVNGKKVVSYRDRVVEECKLVVEKLNWVEVSRTKEITNEGSCEGQSC
KLPDGSLLAHGASQVLYSSSTPVGSCASVSESRTCTNGVLSGSSTHNQVTCHEGCGSFGS
HGTVKTGVITGETKVPLKCSFNEEGFFDLYNEISDQTCTDGQIISSNTRQGTMKEAGKCP
VYKYVPTDKFTACTADCGGKQNRIFVCVDDKGVTVDDSRCADQVKPVEERLCDANPEAVR
SQSSVTTIEEANSSATCPANQIGVIVKTREVVTTKTMACIQHSVQLESEVAVPGAWVEEK
YCRDYVARRCSHDSLSNTEAKGRYDWMVKCQNELPVIKEFLTNFANVTVTVGGKKVGLGS
AGQEIYATFMDRAYSPEKAWIAPKKANAPCTMPATAYVATVCVSSCATPEQQILAEEVVS
KKLKYMSFFDALTSQSPYVGTMQSADSLNKNAVVKTKVDQWVTELVDGDHEILVFKMKSG
RELRVTKNHPVLSQDGSMKVAEEFKVGESLVQSGGTLDAIVSINEIKYFGKVYNVFVQSN
APHKNVVLINGYLNGSAFFQNAGAKEMNRTIFRNNMTRGVFGK
Download sequence
Identical sequences K7YZA7
gi|426404331|ref|YP_007023302.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]