SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr0002s0170.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr0002s0170.1
Domain Number 1 Region: 60-99
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000691
Family 7-Fe ferredoxin 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr0002s0170.1
Sequence length 425
Comment | NADH-plastoquinone oxidoreductase subunit 4, putative | HC | scaffold0002:170293-172871 | 20130731
Sequence
MVRALICLELILNSINLNLVTFSDLFDSRQLKGDIFAIFVIALAAAEAAIGLSILSSIHR
CTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCGSIFFLIGVLGMGLYGSNEPGL
DLERLINQSYPATLEILLYFGFLIAYAVKLPIIPLHTWLPDTHGEAHYSTCMLLAGILLK
MGAYGLIRINMELLPHAHYLFSPWLVIIGAIQIIYAASTSLGQRNFKKRIAYSSVSHMGF
IILGIGSISDTGLNGAILQIISHGFIGAALFFLAGTASDRMRLVYLEELGGISIPMPKIF
TMFSSFSMASLALPGMSGFVAELVVFFGLITSPKFLLMPKALITFVMAIGMILTPIYLLS
MLRQMFYGYKLFNVPNANFVDSGPRELFILICIFLPVIGIGIYPDFVLSLSVDRVEALLS
NYYPK
Download sequence
Identical sequences A0A072TKF2
XP_013443666.1.50012 Medtr0002s0170.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]