SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr1g039010.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr1g039010.1
Domain Number 1 Region: 28-211,346-431
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.29e-57
Family Bacterial dinuclear zinc exopeptidases 0.00000191
Further Details:      
 
Domain Number 2 Region: 214-326
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0000209
Family Bacterial exopeptidase dimerisation domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr1g039010.1
Sequence length 446
Comment | N-acyl-L-amino-acid amidohydrolase | HC | chr1:14405208-14409073 | 20130731
Sequence
MVFNHQNILLISFLLTITTTLTYVKASEESNIISRFQQYLQTRTDHPTPNYTQSTNFLTT
QANSLSLQSQTIEFVSGKPLILLKWTGTNSNLPSIMLYSHTDVVPAEHDKWDHHPFEAHV
DDEGRIYARGSQDMKCVGMQYLEAVRNLKGWDFQPKRTVYLVFAPDEEVGGHDGAEKFSL
SKVFQELNVGVVLDEGLASPDEHYRAFYGERSPWWLVIKAVGAPGHGSKLYDNSAMENLW
KSIENIQRYRASQFDLIKAGLKADGDVVSINMAFLKAGTPSPTGFVMNLQPSEAEAGFDI
RVPPTADTKSLERRIAEEWAPTSRNMSFTFKEKISVHDASGKPVFTKTDSSNPWWALLKN
AVEEAGGKIRKPEVFPASTDGRFFRNLGLPTIGFSPMANTPILLHDHNEYLHKSEYLKGI
KIYESIIKAYASFDEHGRDARSKDEL
Download sequence
Identical sequences G7IBI0
Medtr1g039010.1 XP_003589763.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]